KEGG   Thalassiosira pseudonana: THAPSDRAFT_260943Help
Entry
THAPSDRAFT_260943 CDS       T01078                                 

Definition
transcription factor of TFIIH family
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tps  Thalassiosira pseudonana
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tps00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    THAPSDRAFT_260943
  Replication and repair
   03420 Nucleotide excision repair
    THAPSDRAFT_260943
Transcription machinery [BR:tps03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     THAPSDRAFT_260943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 461 aa AA seqDB search
LFEYLEHLPPQTLKSIYALPAPRGPTVAAAVVRSSALTDIARQCALRLVACGGSFKVESI
VEGWIHRHGRRDAFVALRRLECMGILQPLGLATRFGEDEVLAPEFKAALTAYLATASSSP
WPIITQDHIDEFSMDGGDLETYTQSSWDSVLHFLVGSDETDRGSGYGIEEPPEAMVQFLM
RIGLMQVDPDFKGNDKSRAPLVITSKGYEFMLRDTNAQVWQFVLQYLNSMAHHEQKDFIR
MEALSFLICLGSCRVGEGYQSSVLGSKSARALMRDFSRFGLLFVCRVAGKNSFYPTRAAV
NLVASSEKAGRQASDLMGQTLAAPVPSRSHLAVVVQTNFQVVAYTKSKLHISTLGLFCDV
SSFRRLPNVIFFHITRDSIRSAFRLGVTADQILRFLHVHAHPMLRSGDRPMVPSNVVDQI
LLWDRERHRVVMDEVCVHQCRDAAEFTAVSQYASDVDALAW
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ctcttcgaatacctcgaacatctcccacctcaaactctcaaatcaatctacgccctacct
gctcctcgtggtcccaccgtcgcagctgcagtagttcgttcttcggcattgactgatatt
gcacgacagtgtgctttgcgtctcgtggcatgcggtggtagcttcaaggttgagtccatt
gtggagggttggattcaccgacatggacgtcgggatgcctttgtagccctgcgaagatta
gagtgtatggggatattgcaaccacttggtctagctacacgatttggagaagatgaggtt
cttgcgcccgagttcaaggctgccctgacggcgtatcttgctactgcttcgtcgtctccg
tggccgattattacacaagatcatattgacgagttcagcatggacggaggagatcttgaa
acatatacacaatcgtcttgggattcggtccttcatttcttggtggggtcagatgaaact
gatcgtgggagtggatatggaattgaagaaccgcccgaggcaatggttcagtttctcatg
cgtattggactgatgcaagtagatccagatttcaaaggcaacgacaaatcacgtgcaccc
ctagtcatcacctcgaagggatacgagttcatgcttcgtgatacgaacgcacaagtatgg
caatttgtattgcagtatttgaattcaatggcacatcatgagcaaaaggatttcatacga
atggaggcattgtccttcttgatttgtctggggagctgtcgggtgggagagggataccaa
agcagtgtactggggagcaaatcggcacgtgcactcatgagggacttttctcggtttggg
cttctatttgtgtgtagagtagcggggaagaactcgttttatcccacgagggcagcagtc
aatctagttgcatcaagcgaaaaggcgggacggcaagcatcggatttgatggggcaaacc
ctcgctgctcctgtgccatctcgttcacatttggcggtggttgtgcaaacaaactttcaa
gtggttgcatacaccaagtccaaactgcatatctcaacgctcggtttgttctgtgatgta
tcgtctttccgtcggctgcccaatgtcatcttttttcacatcacccgtgattccatccgt
agtgcatttcggctgggagtgacagcagatcagatactgagattcttacacgttcatgcc
catccaatgcttagatcgggggatcgtcccatggtgccaagcaatgtcgttgaccagatt
ttgctttgggatagagaacggcatcgtgtggtcatggatgaggtgtgcgtccatcagtgt
agagatgctgcggaattcactgcagttagtcaatatgcatcggatgtagatgcacttgcg
tgg

DBGET integrated database retrieval system