KEGG   Thalassiosira pseudonana: THAPSDRAFT_261140Help
Entry
THAPSDRAFT_261140 CDS       T01078                                 

Definition
UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase (EC:2.4.1.122)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
tps  Thalassiosira pseudonana
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 256 aa AA seqDB search
KIMCLVYTMADAHANRIRAMRDTWAGGCDGFLAFSTESDPRLPAISLEHDGPEEYNNMWQ
KIRSIWKFVGTHYLEDYDWFFIGGDDLFVLPHNLKTYLASLTQKDGTDPKTKEYFVGRRF
NSGGTNGYFNSGGAGYSLSQATLRKFFANIEDAQHCSAKSHTSMEDVMIARCLSYLGIHF
TDTRDARGRERFHPFAPGSHLHWSPPGPGKPRDWYEDYNKEWGILTGTDCCAPDSVSFHY
IKKASMVRHMQSLLYF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
aagatcatgtgtttggtgtacaccatggcagacgcccatgccaatcggatacgagccatg
agagacacgtgggctggtgggtgtgatggcttcttggctttctcgaccgagtcagatcct
agactgccagctatatccttggagcacgatggtcccgaagagtataacaacatgtggcaa
aagattcgaagtatttggaagtttgtggggacgcattacctagaggattacgattggttc
ttcatcggaggggatgatttattcgtattgcctcataatttgaagacttatctggcatca
ctgacgcagaaagacgggactgatccaaagacgaaggaatactttgttggaaggagattc
aattcgggtggtaccaatggatacttcaatagtggtggagcgggatattcattgtctcag
gctacgttgcgaaagttctttgccaacatcgaggatgctcagcattgttctgccaaatca
catacttcgatggaagatgtaatgattgcacgttgcttgagttacctagggattcacttt
actgacactcgagatgctaggggcagggaacgtttccatccatttgcaccgggatcgcat
ttgcattggtctccaccgggaccaggaaaacctcgggattggtacgaggattacaacaag
gaatggggcattctgacgggtacagattgttgtgctccggatagtgtgagcttccattac
attaagaaggcgagtatggtgcggcatatgcaatcgttgctgtacttt

DBGET integrated database retrieval system