KEGG   Thalassiosira pseudonana: THAPSDRAFT_261320Help
Entry
THAPSDRAFT_261320 CDS       T01078                                 

Gene name
GLK1
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00010  Glycolysis / Gluconeogenesis
tps00052  Galactose metabolism
tps00500  Starch and sucrose metabolism
tps00520  Amino sugar and nucleotide sugar metabolism
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01130  Biosynthesis of antibiotics
tps01200  Carbon metabolism
Module
tps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tps_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_261320 (GLK1)
   00052 Galactose metabolism
    THAPSDRAFT_261320 (GLK1)
   00500 Starch and sucrose metabolism
    THAPSDRAFT_261320 (GLK1)
   00520 Amino sugar and nucleotide sugar metabolism
    THAPSDRAFT_261320 (GLK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    THAPSDRAFT_261320 (GLK1)
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     THAPSDRAFT_261320 (GLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucokinase DUF3833
Motif
Other DBs
NCBI-GeneID: 7450211
NCBI-ProteinID: XP_002287250
JGI: 261320
UniProt: B8BU30
Position
2
AA seq 286 aa AA seqDB search
ACLAVAGPVQTNNTVYMTNIAGGCTIDGNEIEQCQDGLMELVVRCKLVNDFVGQGYGALD
LDLDTEVVELIPGSKAKIDELGPIVCVGAGTGLGECFLTKSSLRPELGYECYPSEGGHCD
FVPRGPLEVELLNHLKSKFGGENRVSVERVVSGRGLANVYEFLAEKFPERVDKAIHEEFL
QAGDQQGRVVGINAEKEGSLTAQAAQIMFSAYGAEVGNASLKFIPTGGMFVTGGLTAKNI
GLIQGSDSPFMKAYLDKGRLGNVLQTVPLFAVMTEDIGLRGARVCA
NT seq 860 nt NT seq  +upstreamnt  +downstreamnt
gcttgtctggcggtggctgggcctgtgcagacgaacaacacggtgtacatgacaaatatt
gctggaggatgcaccattgatggaaatgagattgaacagtgtcaagatggactgatggag
ttggtagttcgatgtaaacttgtaaatgatttcgttggtcaaggatacggtgcgcttgat
ttggatttggatacggaggttgtagagttgatccctggatccaaggcaaagattgacgag
cttgggccaatagtttgcgtgggtgctggtactggtcttggggagtgttttctaacaaaa
tctagtttgagacctgagttaggttacgagtgctatccatcagaaggtggacactgtgac
ttcgttccaagaggtcctctcgaggttgaactattgaatcatctcaagagcaagtttggt
ggagaaaatagagtttcggtagaacgagtagtgtccgggcgaggattggctaacgtgtac
gagttccttgcagagaagttccctgaaagagtcgataaagctatccacgaagagttcttg
caagccggagatcaacagggacgagttgtcggaataaacgctgaaaaggaagggagtttg
actgctcaagcagctcaaataatgttttcggcctatggagcggaagtaggcaacgcatcg
cttaagttcattcctactggagggatgtttgttacgggtggtcttactgcgaagaacatt
ggcttgattcaaggcagtgacagtcctttcatgaaagcttacttggacaaaggacgtttg
gggaatgtacttcagacggtgcctctgtttgcggtcatgacggaggacattggcttgagg
ggagctcgtgtttgtgctga

DBGET integrated database retrieval system