KEGG   Thalassiosira pseudonana: THAPSDRAFT_261320Help
Entry
THAPSDRAFT_261320 CDS       T01078                                 

Gene name
GLK1
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THAPSDRAFT_261320 (GLK1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_261320 (GLK1)
   00052 Galactose metabolism
    THAPSDRAFT_261320 (GLK1)
   00500 Starch and sucrose metabolism
    THAPSDRAFT_261320 (GLK1)
   00520 Amino sugar and nucleotide sugar metabolism
    THAPSDRAFT_261320 (GLK1)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    THAPSDRAFT_261320 (GLK1)
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     THAPSDRAFT_261320 (GLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 286 aa AA seqDB search
ACLAVAGPVQTNNTVYMTNIAGGCTIDGNEIEQCQDGLMELVVRCKLVNDFVGQGYGALD
LDLDTEVVELIPGSKAKIDELGPIVCVGAGTGLGECFLTKSSLRPELGYECYPSEGGHCD
FVPRGPLEVELLNHLKSKFGGENRVSVERVVSGRGLANVYEFLAEKFPERVDKAIHEEFL
QAGDQQGRVVGINAEKEGSLTAQAAQIMFSAYGAEVGNASLKFIPTGGMFVTGGLTAKNI
GLIQGSDSPFMKAYLDKGRLGNVLQTVPLFAVMTEDIGLRGARVCA
NT seq 860 nt NT seq  +upstreamnt  +downstreamnt
gcttgtctggcggtggctgggcctgtgcagacgaacaacacggtgtacatgacaaatatt
gctggaggatgcaccattgatggaaatgagattgaacagtgtcaagatggactgatggag
ttggtagttcgatgtaaacttgtaaatgatttcgttggtcaaggatacggtgcgcttgat
ttggatttggatacggaggttgtagagttgatccctggatccaaggcaaagattgacgag
cttgggccaatagtttgcgtgggtgctggtactggtcttggggagtgttttctaacaaaa
tctagtttgagacctgagttaggttacgagtgctatccatcagaaggtggacactgtgac
ttcgttccaagaggtcctctcgaggttgaactattgaatcatctcaagagcaagtttggt
ggagaaaatagagtttcggtagaacgagtagtgtccgggcgaggattggctaacgtgtac
gagttccttgcagagaagttccctgaaagagtcgataaagctatccacgaagagttcttg
caagccggagatcaacagggacgagttgtcggaataaacgctgaaaaggaagggagtttg
actgctcaagcagctcaaataatgttttcggcctatggagcggaagtaggcaacgcatcg
cttaagttcattcctactggagggatgtttgttacgggtggtcttactgcgaagaacatt
ggcttgattcaaggcagtgacagtcctttcatgaaagcttacttggacaaaggacgtttg
gggaatgtacttcagacggtgcctctgtttgcggtcatgacggaggacattggcttgagg
ggagctcgtgtttgtgctga

DBGET integrated database retrieval system