KEGG   Thalassiosira pseudonana: THAPSDRAFT_261433Help
Entry
THAPSDRAFT_261433 CDS       T01078                                 

Definition
elongation factor-2 kinase like protein (EC:2.7.1.-)
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     THAPSDRAFT_261433
Protein kinases [BR:tps01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   THAPSDRAFT_261433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 668 aa AA seqDB search
MTATPYNREEVQRSLREKIWRAAATAVSEEDPWKKHDITSIPAERVVRHCYNPNTRQFKK
DETIVKVEKEPFTHGAMRHCFRLKKLATPPQSSSNHRFHSYGWSRALNYVAKCYLKEDGT
IDTSRKGTDNVLTDIILQYEAAHWSALFNEANPPRKIDFIRAYAMEFVDRPGKPMFAVER
YIAGNDSYGCGFHKHNTNSGFIDLEIRRKTPQVFSAHSFYASEGTRLVADVQGVGDLYTD
PQVLSIDYRFGDGDLGPRGMALFFKTFRHCDMSDLLGIPIFPLSRNERRHQAKYDDEEST
LSEASSAVEEDLRCRFKMLDANRQRRKTVLMRPIDIMQSEDKADTAKRSNISNVSLTIRQ
SMRQLNIQKSVIHRSKSDVDEITSCLQMAVTDAVFDHTAFHRYESGELKPRHFHGTPKHQ
TQLTVVPVKASPPMKITDETKANLGKVHYHLACLHGLDRFPEIVPTNASSGVEDLPSHDV
FSVVFHLSHAASLYNVPACLSLARALIGLDSSVSPLLKANVRIDFELSKDLCWRGMTAQK
ARAAPKVAAGCLLYQILEDEGTTGDVEKMNILEETLNQMKVATEEEAILKEHANKLTRDE
EALGSVNTDEECLFEDYELMAKLADLKVKAGKRNDARVLYQDAAELAMSAGKMKTANCLS
MKAAQLEG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgacagctacaccgtataacagggaggaagtgcagaggagccttcgtgaaaaaatctgg
agagctgctgccacggccgtatcagaggaagatccatggaagaaacatgacataacatca
atccctgccgaacgtgtagttcgacactgttacaaccccaacactcgccagtttaaaaag
gatgagacgatcgtcaaggtggagaaggaacctttcactcacggggcgatgcgacattgt
ttcagattgaagaagctagcaactccaccacaatcatcatccaaccatcgattccacagt
tatggatggagtagggcgttgaactatgttgcaaagtgctatctaaaagaagacgggaca
atcgatacgagccgaaagggaacagacaacgtactgacggatattattctacaatacgaa
gctgcccattggtcggccctctttaacgaagctaatcctcctagaaagattgatttcatt
agagcttatgccatggagtttgtggatcgtccaggcaaaccaatgtttgcagttgagcgc
tacattgcggggaacgatagctacggatgtggtttccacaaacacaataccaactctggt
ttcattgacttggagatacgccggaagactcctcaggtgttttcagctcatagcttctac
gcttcggaagggacgagactcgttgcagatgttcagggcgtgggagatctttatactgat
ccgcaggtgctatccattgactatcgctttggtgacggagatctcggccctagaggaatg
gctttgttcttcaaaacctttcgtcattgtgatatgagcgaccttctggggattccaatc
tttccactatcaagaaatgaacgtcgccaccaggctaaatacgatgacgaagaaagcact
ttaagtgaagcgtcatctgctgtagaggaagatctaaggtgcagattcaagatgctagat
gccaataggcaacggaggaaaacagtcttaatgagaccgattgacatcatgcaatcagag
gacaaggccgacaccgcgaaaaggtctaatatttccaacgtctcgttgacgattcgtcaa
tccatgagacaactgaacatacaaaagtcagtgattcatcgttcaaaatcggatgtcgat
gagatcacatcctgcttgcaaatggcagtgactgatgcggtatttgatcacacagcgttt
catagatacgaatctggagaactgaaacctcgtcacttccacgggacaccgaagcatcaa
actcagttaaccgtggtaccagtgaaagcatcgccgccaatgaagataactgacgagaca
aaggcaaatctcggcaaagtccactaccacttagcctgtcttcacgggctagatcgcttc
ccagagattgttcctaccaatgcgtcctctggcgtggaggatcttcccagccatgatgtc
ttctctgtggtgtttcatctctctcatgcagcgtcactctacaacgtaccagcttgtctc
tcattggctcgtgctctaattggccttgatagctcggtatctcctttgctcaaagcgaac
gtccgtattgattttgagctatcaaaggatttgtgctggcgagggatgactgctcaaaag
gcccgtgctgctccgaaagttgcggctggttgtttgttgtatcaaatccttgaagacgaa
ggtacaacaggcgatgtagaaaagatgaacattctagaggagacgctgaaccagatgaaa
gttgctaccgaagaggaagccattttgaaggagcatgcaaacaaattaacccgagatgaa
gaagcattgggcagcgttaacactgatgaagagtgcttgtttgaagactatgagttgatg
gctaaactcgcggacttgaaagtgaaggctggaaagcgaaacgatgcgcgggtgctatat
caggatgcagcagagcttgccatgtctgcgggtaagatgaagacggcgaattgcttgagt
atgaaggccgcccaacttgaaggttag

DBGET integrated database retrieval system