KEGG   Thalassiosira pseudonana: THAPSDRAFT_261719Help
Entry
THAPSDRAFT_261719 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
tps  Thalassiosira pseudonana
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    THAPSDRAFT_261719
Enzymes [BR:tps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     THAPSDRAFT_261719
Exosome [BR:tps04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   THAPSDRAFT_261719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 164 aa AA seqDB search
SASDVLQAVDKFCTSRHWMMHVGPEKGEILTGALREAMDAKLASQLGSYCCYSSILMARE
FYKQQYAKLNSHLFTVEINPEYAKVAAEMARLSGLNGKITVHEISYNGHDTDVDTIDFLF
IDHDKDMYKADLIKLESAGLVRQGTKVVADNVLFAQIDDYIEYV
NT seq 493 nt NT seq  +upstreamnt  +downstreamnt
agcgcaagtgatgttttgcaagcagtggataagttctgtacgtcgaggcactggatgatg
cacgttggtccagagaagggtgagatactgactggggcgttgagagaagcgatggatgcc
aaactagcatcacaactcggttcgtactgttgttattcatcgatattgatggcacgagag
ttttacaaacaacaatatgcaaagctaaatagtcatttattcacggttgagattaatcca
gagtatgcgaaagtcgccgctgaaatggcacgtctcagtggacttaatggcaagataaca
gttcatgaaatcagctacaatggacatgataccgatgttgatactattgactttcttttc
attgatcatgacaaggatatgtacaaagccgatctcatcaagttagaatctgctggttta
gtccgtcaaggtaccaaggttgtagctgacaatgttctgtttgctcaaattgacgattac
attgagtacgttc

DBGET integrated database retrieval system