KEGG   Thalassiosira pseudonana: THAPSDRAFT_261719Help
Entry
THAPSDRAFT_261719 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
tps  Thalassiosira pseudonana
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:tps00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 164 aa AA seqDB search
SASDVLQAVDKFCTSRHWMMHVGPEKGEILTGALREAMDAKLASQLGSYCCYSSILMARE
FYKQQYAKLNSHLFTVEINPEYAKVAAEMARLSGLNGKITVHEISYNGHDTDVDTIDFLF
IDHDKDMYKADLIKLESAGLVRQGTKVVADNVLFAQIDDYIEYV
NT seq 493 nt NT seq  +upstreamnt  +downstreamnt
agcgcaagtgatgttttgcaagcagtggataagttctgtacgtcgaggcactggatgatg
cacgttggtccagagaagggtgagatactgactggggcgttgagagaagcgatggatgcc
aaactagcatcacaactcggttcgtactgttgttattcatcgatattgatggcacgagag
ttttacaaacaacaatatgcaaagctaaatagtcatttattcacggttgagattaatcca
gagtatgcgaaagtcgccgctgaaatggcacgtctcagtggacttaatggcaagataaca
gttcatgaaatcagctacaatggacatgataccgatgttgatactattgactttcttttc
attgatcatgacaaggatatgtacaaagccgatctcatcaagttagaatctgctggttta
gtccgtcaaggtaccaaggttgtagctgacaatgttctgtttgctcaaattgacgattac
attgagtacgttc

DBGET integrated database retrieval system