KEGG   Thalassiosira pseudonana: THAPSDRAFT_261905Help
Entry
THAPSDRAFT_261905 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tps  Thalassiosira pseudonana
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THAPSDRAFT_261905
  Carbohydrate metabolism
   00640 Propanoate metabolism
    THAPSDRAFT_261905
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    THAPSDRAFT_261905
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    THAPSDRAFT_261905
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     THAPSDRAFT_261905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 360 aa AA seqDB search
LLPSRASNLGILQLNNPSSLNALTLDMIRSMTSTLQHWQSGSSAIRATLIPAFCAGGDVK
TVYLAGSSDDRKLTADFFREEYQLNHLIATQLPHVPQVSLWDGVVMGGGVGLSIHGKYRV
ATENTLFAMPECKIGLYPDVGGSWWIPRLKLYQQQQGMVGGIGNYLALTGARLKAEDLLY
TGIATHYVKSDQLEELKRALIESTAKEGSPLGDCAASVLMSFHDHSIDVKSAFLSQNRTE
IDQAFHGKDRVEDIVATLESMGSESQFAQSTLEALKQMSPTSLKVTLEGLKRGLKLNNVG
ECLAMEYRIVQTAMKEGSDFYDGIRAALVDKDGEPKWNPARLEDVTDGMVDSFFDDLGDD
NT seq 1081 nt NT seq  +upstreamnt  +downstreamnt
ctcttgccctcgagggcctccaatctcggcatccttcaattgaacaacccatcttcgcta
aatgcattgacactggacatgatacgaagcatgacctccactttgcaacattggcagagt
ggaagtagtgcaattcgtgccacactcataccggctttttgtgctggtggagacgtcaag
acagtgtatttggctgggtcgtcggatgatcggaaactcactgcagacttcttccgagaa
gagtatcaactaaatcacttgattgcgacgcagctccctcacgtgcctcaagtatcgttg
tgggacggtgttgtcatgggtggaggagttggtctttcaattcatggaaaataccgtgtg
gctactgagaatactctgtttgcgatgccagagtgtaagattggattgtacccagatgtg
ggaggaagttggtggattccgagattgaaattgtaccaacaacaacagggtatggtggga
ggtattggaaactatttggcgttgactggagcaaggttgaaagcagaagacttgctatat
actggaattgcaacgcattacgtcaagtcagaccagttggaagaattgaagcgtgcattg
attgaatccactgcaaaggaaggctcgccattaggagattgtgctgccagtgttctcatg
tcatttcacgatcacagtattgatgtaaagtctgcttttctttcacagaacagaactgag
attgaccaggcatttcatgggaaggatagagtagaagatatcgttgcaactttggaaagc
atgggaagcgaatctcaatttgcacaatctactttggaggcactgaagcaaatgtctcct
actagccttaaagtgacattagaaggattgaaaagaggactaaaattgaacaatgtgggc
gaatgtttggcaatggaatataggattgtacaaactgcaatgaaggagggaagcgatttc
tatgatggtattcgagctgcgttggtggataaagacggggagccaaagtggaatccagct
cggttggaagatgttactgatgggatggtggacagtttctttgatgatttgggagacgat
g

DBGET integrated database retrieval system