KEGG   Thalassiosira pseudonana: THAPSDRAFT_262059Help
Entry
THAPSDRAFT_262059 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tps  Thalassiosira pseudonana
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    THAPSDRAFT_262059
   00052 Galactose metabolism
    THAPSDRAFT_262059
   00500 Starch and sucrose metabolism
    THAPSDRAFT_262059
   00520 Amino sugar and nucleotide sugar metabolism
    THAPSDRAFT_262059
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     THAPSDRAFT_262059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 431 aa AA seqDB search
IAQSAISAFESTFNSLVSGNTGMIPESTITPVPELVHTDSITAKPNAGLLAETVVLKLNG
GLGTGMGLDKAKSLLEVKNGDTFLDLTAKQVMCMRKDFGENVKFMLMNSFSTSDDTMEFF
RTKYPSLAAEEGLEMLQNKSDPSNEWCPPGHGDLYAALIGSGRLAALLKSGYKYMFVSNS
DNLGATLDLKILTHFADTNASFMMECCERTENDKKGGHLAIRNSDQHLILRESAMCADED
ENEFQDITKHRFFNTNNLWIRLDKLQEIVEKFGGFIPLPMIMNSKTVDPKDDNSQKVVQL
ETAMGAAIECFDGASAVIVPRTRFAPVKKCNDLLLLRSDAYVITEDFRPVLNPACGGVAP
VIDLDSKKYKLVGALEDATVNGCPSLVNCKRLKVKGVVRFGRSTRFVGSVSITNTSDESK
YVSGKIEDADL
NT seq 1295 nt NT seq  +upstreamnt  +downstreamnt
atcgcccagtccgctatctccgccttcgaatccaccttcaactccctcgtcagcggaaat
accggaatgattcccgaatccaccatcactcccgttcccgaactcgtccacaccgactcc
atcaccgccaaacccaacgctggtctactcgccgagactgttgttctcaagctcaacggt
ggattgggaactgggatgggattggacaaggccaagagtcttttggaggtgaagaatggt
gatacgtttttggatttgaccgccaaacaggtgatgtgcatgaggaaggatttcggggag
aatgtcaagttcatgttgatgaactcgttttctacgagtgacgatacgatggagttcttt
aggacgaagtaccctagtttggctgcggaggagggattggagatgttgcagaataagtcc
gatccaagcaatgaatggtgccctcctggtcacggagatctttacgccgccctcatcgga
tctggacgtctcgcagccctccttaagtctggctacaagtacatgttcgtctccaactct
gacaaccttggtgccactcttgacttgaaaatcctcacccactttgccgacaccaacgcc
tccttcatgatggagtgctgtgaacgtacagagaatgacaaaaagggaggtcatcttgcc
atccgtaacagtgaccagcacttgattcttcgtgagtctgccatgtgtgctgatgaggac
gagaatgaatttcaagatattaccaagcaccgtttcttcaacaccaacaacctctggatc
cgccttgacaagttgcaagagattgttgagaagttcggtggcttcatcccccttcctatg
atcatgaactccaaaaccgtggatcccaaggatgataactcccagaaggtggttcaactt
gaaaccgcgatgggtgcagccattgaatgtttcgatggagccagtgccgtcattgtacct
cgtactcgtttcgcacctgtaaagaagtgcaatgatcttctccttcttcgaagtgatgcc
tacgtaatcactgaggactttcgtcccgttctcaaccctgcttgtgggggtgttgctcca
gtcattgatcttgattccaagaagtacaaacttgtgggtgctttggaggatgccactgtc
aatggatgcccttctcttgtgaactgcaagcgtcttaaggtgaagggagtggttcgcttt
ggaaggtctactcgtttcgttggcagcgtgtctatcaccaacaccagtgatgagtcaaag
tacgtgtctggaaagattgaggatgctgatcttga

DBGET integrated database retrieval system