KEGG   Thalassiosira pseudonana: THAPSDRAFT_262287Help
Entry
THAPSDRAFT_262287 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
tps  Thalassiosira pseudonana
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 271 aa AA seqDB search
MLTEKVFVDLTNHEAAEKRAEHGLAQRKRVKIFCLVYTIEKFHDRIPPIRDTWGKNCDGF
MVASTKTDAKLGTVNIPHEGPEEYNNIWQKVRAMWSYVYDNYYEKYDYFHIGGDDLYLIV
ENLRLYLEKESQTPLFLGRRFAEGGDRDRMFISGGSGYTMNKATLKTLVVDGFPNCFPHM
KTFSEDVMVATCLRKMDIIPYDTKDEARGERYMPFQPGHHLTYTPPKNPKDDWYSNYSVD
CLWGIDHSAAKSVAFHYIKEDLMRRMHAILY
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggagaaggtgtttgtcgacctcacaaatcacgaggcagcggagaaacgagct
gagcatggattagcacagaggaagcgagtaaagatattctgcttagtgtataccattgag
aagttccacgacagaatccctcccatacgtgacacgtggggtaagaattgtgatggtttc
atggttgcgagtaccaagacagatgccaagttgggaactgtgaacattcctcatgaagga
ccggaggagtacaacaacatctggcaaaaagtcagagcgatgtggtcttacgtttacgac
aactactacgaaaagtacgactactttcacatcggaggtgatgacttgtatctcattgtt
gaaaatctcagactataccttgagaaggaatcacaaacgccacttttcttggggcgacgt
tttgctgaaggaggggaccgagatcgtatgttcatctctggaggcagcggatacactatg
aacaaagcaacattgaaaactcttgttgtagacggatttcctaactgctttcctcacatg
aaaaccttctcggaagacgtaatggttgcgacgtgtttgcgaaagatggatatcattccc
tacgatacaaaggacgaagcaagaggagagaggtacatgcccttccaaccaggccaccac
ctaacttacaccccgccaaagaatccgaaggatgattggtacagtaactacagtgttgat
tgtttgtggggaattgatcattctgcagcaaagagcgttgcttttcattatatcaaggaa
gatctaatgaggcgtatgcatgcaattctgtat

DBGET integrated database retrieval system