KEGG   Thalassiosira pseudonana: THAPSDRAFT_262513Help
Entry
THAPSDRAFT_262513 CDS       T01078                                 

Gene name
RPA2_2
Definition
replication protein A2
Orthology
K10739  
replication factor A2
Organism
tps  Thalassiosira pseudonana
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:tps03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tps03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tps03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tps03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 288 aa AA seqDB search
LSSSLPKTPTGFDNEGGFGSQNTPSRGGSSDGKPRRDYDAQTLIPVTIKMILDAYATPGA
AGGSGDLQLKDERPIHMVKVVVAVRSHEERSTNLFLDIEDGTGFTQAKVWVNEGDECSGV
VQLRQNACKDHQYVRIIGQVREFDGTRQIVANDVRPVSSGDEITYHFLEVAHSYEKHMKR
QQQGGGMGIGGAMGYGIGNMASAPPQQGGLGISAQSGGNMGGGSALNDAVLAFIQGAGNN
NDSGVHVNEITAKVSANGFTESDVRTAINNLSNEGHIYSTIDENHYQY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ctctcttcctccctacccaaaacaccaacaggattcgacaacgaaggaggcttcggctcc
caaaacaccccctctcgcggaggctcctccgacggcaaacctcgccgcgactacgacgcc
cagacactcatcccggtcactatcaaaatgatcctcgatgcctatgccaccccgggtgct
gccggtggatcgggggacttgcaattgaaggacgagaggcccattcatatggtcaaggtt
gtagttgcggtgaggagtcatgaggagcggtccactaatttgtttttggatattgaggat
ggtacgggctttactcaggcgaaggtttgggtgaatgagggagatgaatgtagtggtgtg
gtgcagttgaggcagaatgcctgtaaggatcatcagtatgttcgtattattggacaggtg
agggagtttgatggtacgaggcaaattgtcgccaatgatgtcaggccggtgagttcggga
gatgaaatcacctatcatttcttggaggtggctcattcgtatgagaagcatatgaagagg
cagcagcagggcggagggatgggaattggaggtgccatgggatatgggattggtaatatg
gcaagtgctcctcctcagcaggggggtttgggaattagtgctcagtctggggggaatatg
ggtggggggagtgcacttaatgatgcggtgcttgccttcatccagggtgctggcaacaac
aacgattcgggtgtacacgtgaatgaaatcacagcgaaggtctcagccaatggctttacc
gagagtgacgttagaactgcaatcaacaacttatccaatgaggggcatatttactctaca
atcgatgaaaatcactatcagtat

DBGET integrated database retrieval system