KEGG   Thalassiosira pseudonana: THAPSDRAFT_262513Help
Entry
THAPSDRAFT_262513 CDS       T01078                                 

Gene name
RPA2_2
Definition
replication protein A2
Orthology
K10739  
replication factor A2
Organism
tps  Thalassiosira pseudonana
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:tps00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    THAPSDRAFT_262513 (RPA2_2)
   03420 Nucleotide excision repair
    THAPSDRAFT_262513 (RPA2_2)
   03430 Mismatch repair
    THAPSDRAFT_262513 (RPA2_2)
   03440 Homologous recombination
    THAPSDRAFT_262513 (RPA2_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 288 aa AA seqDB search
LSSSLPKTPTGFDNEGGFGSQNTPSRGGSSDGKPRRDYDAQTLIPVTIKMILDAYATPGA
AGGSGDLQLKDERPIHMVKVVVAVRSHEERSTNLFLDIEDGTGFTQAKVWVNEGDECSGV
VQLRQNACKDHQYVRIIGQVREFDGTRQIVANDVRPVSSGDEITYHFLEVAHSYEKHMKR
QQQGGGMGIGGAMGYGIGNMASAPPQQGGLGISAQSGGNMGGGSALNDAVLAFIQGAGNN
NDSGVHVNEITAKVSANGFTESDVRTAINNLSNEGHIYSTIDENHYQY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ctctcttcctccctacccaaaacaccaacaggattcgacaacgaaggaggcttcggctcc
caaaacaccccctctcgcggaggctcctccgacggcaaacctcgccgcgactacgacgcc
cagacactcatcccggtcactatcaaaatgatcctcgatgcctatgccaccccgggtgct
gccggtggatcgggggacttgcaattgaaggacgagaggcccattcatatggtcaaggtt
gtagttgcggtgaggagtcatgaggagcggtccactaatttgtttttggatattgaggat
ggtacgggctttactcaggcgaaggtttgggtgaatgagggagatgaatgtagtggtgtg
gtgcagttgaggcagaatgcctgtaaggatcatcagtatgttcgtattattggacaggtg
agggagtttgatggtacgaggcaaattgtcgccaatgatgtcaggccggtgagttcggga
gatgaaatcacctatcatttcttggaggtggctcattcgtatgagaagcatatgaagagg
cagcagcagggcggagggatgggaattggaggtgccatgggatatgggattggtaatatg
gcaagtgctcctcctcagcaggggggtttgggaattagtgctcagtctggggggaatatg
ggtggggggagtgcacttaatgatgcggtgcttgccttcatccagggtgctggcaacaac
aacgattcgggtgtacacgtgaatgaaatcacagcgaaggtctcagccaatggctttacc
gagagtgacgttagaactgcaatcaacaacttatccaatgaggggcatatttactctaca
atcgatgaaaatcactatcagtat

DBGET integrated database retrieval system