KEGG   Thalassiosira pseudonana: THAPSDRAFT_26293Help
Entry
THAPSDRAFT_26293  CDS       T01078                                 

Definition
probable malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tps  Thalassiosira pseudonana
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tps01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tps00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tps00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 555 aa AA seqDB search
MEARSPTVQIEVHAPICAAASEILTPDSLRFVGYLCNKFEDRRQALLNARKSKAMEFDSG
GLPHFEKSDGSGSGGDPHWRCASIPGDVMDRRVEITGPVDRKMVINGLNSGANVYMADFE
DSTSPTWSNLTEGQRNLRDATRGKITYTNKQTGRVYALKEKTAVLFVRPRGWHLDEAHVT
VNGRVASGSLFDFALYFYHNVHCLLQKGSRPYFYLPKLEHYLEARLWNDVFKAAQSYFGV
PYGTIRATVLLETITAAFQMEEILYELRDHSLGLNCGRWDYLFSYIKKFKCHDDKIAPDR
SHLTMTDTPLLKSYVDRLIYICHKRGTFAMGGMAAQIPIKGDPAANEAAMARIEKDKIRE
ALAGHDGTWVAHPALVSLAKAVFDRYMPTPNQIDKNPGLTGKDVTEADLLRLQLVPKGTA
ITSTGLQKGVSIVLAYTEAWLRGIGCIPLNHHMEDAATAEISRAQIWQWKYHGVKTEDDG
IVISASRISKLVHDEVKRCSGGEDRGKWFLAGKLVEDMLTKDRLDDFLTTVCYPHILTTR
YEGDVIPEDEPSSKL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgcgctcacccaccgttcaaattgaagtgcacgctccaatttgcgctgctgca
tccgagatcctcacgcccgattccctccgcttcgtaggctacctctgcaacaagtttgaa
gatcgtcgtcaagccttattgaatgcacgaaagagtaaggctatggagtttgatagtggt
ggcttgcctcattttgagaagagtgatggtagtggcagtggcggtgatcctcattggagg
tgtgctagtattccgggggatgtgatggatcgtcgtgtggagatcactggacccgtcgat
cgcaagatggtcatcaacggtctaaatagcggtgcgaacgtctacatggcagactttgaa
gactccacatcccctacttggtccaatctcaccgaaggccaaaggaacctacgcgatgct
acacgtggtaaaatcacctacaccaataagcagactggacgagtgtatgctctcaaggaa
aagaccgccgtgctatttgttcgtcctagaggatggcatttggatgaggcacatgtgact
gtgaatggcagggttgcctcggggagtttgtttgattttgcgctgtacttctatcacaat
gtgcattgtcttttgcaaaagggatctcgtccttacttctacttgccaaagttggagcat
tacttggaggcacggttgtggaatgatgtgtttaaggctgctcagagttattttggagtt
ccttacggtactattcgtgccacggttttgttggagacgatcacagctgcttttcagatg
gaggagatactttacgagctgcgagatcactctctcggtttgaactgtggccgttgggac
tatctcttttcttatatcaaaaagttcaaatgtcatgatgacaagattgctccagacaga
tcccatcttaccatgacggatactcctttgttgaagagttacgtagatcggttgatttac
atttgtcacaagagagggacatttgcgatgggagggatggctgcacagatacccatcaaa
ggagatccagctgccaatgaggccgcgatggcgaggattgagaaggataagattagagag
gccttggctggtcacgatggaacttgggttgcacacccagcattggtgtcgttggcgaag
gctgtctttgataggtatatgccaacaccaaatcagattgacaagaatccgggtttgaca
ggcaaggacgtgacggaagctgacttgttgagattgcagttagttccgaaagggactgca
attacgagcactggtcttcaaaagggagtttcaattgtgcttgcatacacggaggcttgg
cttcgtggcattgggtgcatccctttgaatcatcatatggaggacgcggcaactgctgag
atttcgagggctcagatttggcaatggaagtaccacggggtaaaaacggaagacgatggc
attgttattagtgcatcacggatctccaaattggttcacgacgaggtgaagcgttgcagt
ggtggagaggatagaggaaaatggttcttggctggcaagttggtggaggacatgttgacg
aaagacaggcttgatgacttcttgacaactgtctgctacccacacattctcacaactcgt
tacgagggagatgttattccagaggatgaaccgtcttcaaagctttga

DBGET integrated database retrieval system