KEGG   Thalassiosira pseudonana: THAPSDRAFT_26293Help
Entry
THAPSDRAFT_26293  CDS       T01078                                 

Definition
(RefSeq) probable malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00620  Pyruvate metabolism
tps00630  Glyoxylate and dicarboxylate metabolism
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    THAPSDRAFT_26293
   00630 Glyoxylate and dicarboxylate metabolism
    THAPSDRAFT_26293
Enzymes [BR:tps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     THAPSDRAFT_26293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 7442396
NCBI-ProteinID: XP_002291513
JGI: 26293
UniProt: B8C648
Position
6
AA seq 555 aa AA seqDB search
MEARSPTVQIEVHAPICAAASEILTPDSLRFVGYLCNKFEDRRQALLNARKSKAMEFDSG
GLPHFEKSDGSGSGGDPHWRCASIPGDVMDRRVEITGPVDRKMVINGLNSGANVYMADFE
DSTSPTWSNLTEGQRNLRDATRGKITYTNKQTGRVYALKEKTAVLFVRPRGWHLDEAHVT
VNGRVASGSLFDFALYFYHNVHCLLQKGSRPYFYLPKLEHYLEARLWNDVFKAAQSYFGV
PYGTIRATVLLETITAAFQMEEILYELRDHSLGLNCGRWDYLFSYIKKFKCHDDKIAPDR
SHLTMTDTPLLKSYVDRLIYICHKRGTFAMGGMAAQIPIKGDPAANEAAMARIEKDKIRE
ALAGHDGTWVAHPALVSLAKAVFDRYMPTPNQIDKNPGLTGKDVTEADLLRLQLVPKGTA
ITSTGLQKGVSIVLAYTEAWLRGIGCIPLNHHMEDAATAEISRAQIWQWKYHGVKTEDDG
IVISASRISKLVHDEVKRCSGGEDRGKWFLAGKLVEDMLTKDRLDDFLTTVCYPHILTTR
YEGDVIPEDEPSSKL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgcgctcacccaccgttcaaattgaagtgcacgctccaatttgcgctgctgca
tccgagatcctcacgcccgattccctccgcttcgtaggctacctctgcaacaagtttgaa
gatcgtcgtcaagccttattgaatgcacgaaagagtaaggctatggagtttgatagtggt
ggcttgcctcattttgagaagagtgatggtagtggcagtggcggtgatcctcattggagg
tgtgctagtattccgggggatgtgatggatcgtcgtgtggagatcactggacccgtcgat
cgcaagatggtcatcaacggtctaaatagcggtgcgaacgtctacatggcagactttgaa
gactccacatcccctacttggtccaatctcaccgaaggccaaaggaacctacgcgatgct
acacgtggtaaaatcacctacaccaataagcagactggacgagtgtatgctctcaaggaa
aagaccgccgtgctatttgttcgtcctagaggatggcatttggatgaggcacatgtgact
gtgaatggcagggttgcctcggggagtttgtttgattttgcgctgtacttctatcacaat
gtgcattgtcttttgcaaaagggatctcgtccttacttctacttgccaaagttggagcat
tacttggaggcacggttgtggaatgatgtgtttaaggctgctcagagttattttggagtt
ccttacggtactattcgtgccacggttttgttggagacgatcacagctgcttttcagatg
gaggagatactttacgagctgcgagatcactctctcggtttgaactgtggccgttgggac
tatctcttttcttatatcaaaaagttcaaatgtcatgatgacaagattgctccagacaga
tcccatcttaccatgacggatactcctttgttgaagagttacgtagatcggttgatttac
atttgtcacaagagagggacatttgcgatgggagggatggctgcacagatacccatcaaa
ggagatccagctgccaatgaggccgcgatggcgaggattgagaaggataagattagagag
gccttggctggtcacgatggaacttgggttgcacacccagcattggtgtcgttggcgaag
gctgtctttgataggtatatgccaacaccaaatcagattgacaagaatccgggtttgaca
ggcaaggacgtgacggaagctgacttgttgagattgcagttagttccgaaagggactgca
attacgagcactggtcttcaaaagggagtttcaattgtgcttgcatacacggaggcttgg
cttcgtggcattgggtgcatccctttgaatcatcatatggaggacgcggcaactgctgag
atttcgagggctcagatttggcaatggaagtaccacggggtaaaaacggaagacgatggc
attgttattagtgcatcacggatctccaaattggttcacgacgaggtgaagcgttgcagt
ggtggagaggatagaggaaaatggttcttggctggcaagttggtggaggacatgttgacg
aaagacaggcttgatgacttcttgacaactgtctgctacccacacattctcacaactcgt
tacgagggagatgttattccagaggatgaaccgtcttcaaagctttga

DBGET integrated database retrieval system