KEGG   Thalassiosira pseudonana: THAPSDRAFT_263452Help
Entry
THAPSDRAFT_263452 CDS       T01078                                 

Definition
trypsin-like serine protease
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
tps  Thalassiosira pseudonana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 238 aa AA seqDB search
TRIVGGSQVSYCRYSYTVSLQDSIGHFCGGSLIAKDVVLTAAHCQGGNYDVVINRHDLGT
NTGDRIKMVKEIPHPKYNDRTTNYDFNLVFLDRPTNQNVALVNLNDNKNSPSVNEEVWVM
GWGDTVADDYVQRLSDKLMDVSVNVISNGDCDASEGSINGQISDQMLCARDNNEDACQGD
SGGPLVLRGNDNSGAKDVQVGVVSWGIGCASKSFPGVYSRVSEAYDWIKDEVCSRSSD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
acaagaatcgtcggtggatcccaggttagttattgccgatattcctacactgtctcactc
caagatagcatcggccacttctgcggtggctctctcattgctaaggacgtagtactcaca
gcagcacattgccaaggtggtaactacgacgtagtaattaatcgtcacgaccttggtacc
aacacgggagacaggatcaaaatggtcaaggagattccacacccaaagtacaatgataga
actaccaattacgactttaacttggtattcttggatagaccgaccaatcagaatgtggca
cttgtcaatttgaacgataataagaattctccaagtgtgaacgaggaggtttgggttatg
ggttggggggatacggttgccgatgactacgtgcaacgtttgagcgacaagcttatggat
gtgagtgtgaatgtcatctctaatggggactgtgatgctagtgaaggctccatcaatggg
cagatctccgatcagatgctttgtgcaagagataataacgaggacgcctgccaaggtgat
tcaggggggcctttagtcctcagaggcaacgataattcaggtgcaaaggacgtacaagtt
ggcgttgtttcatggggcattggttgtgcatccaagtccttcccgggtgtgtacagtcgc
gtcagtgaagcctacgattggatcaaggatgaagtctgcagtagatcgtcagat

DBGET integrated database retrieval system