KEGG   Thalassiosira pseudonana: THAPSDRAFT_263722Help
Entry
THAPSDRAFT_263722 CDS       T01078                                 

Definition
bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tps  Thalassiosira pseudonana
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tps00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 304 aa AA seqDB search
LSKKDASPVTIGDFASQALALQLLFNRFPNDMYIAEEGSEALRLDEELLERVWKAVNSAW
SSLDSDNNVWYERGELLRAIDYGQGKGMPVVSATATTRRRRVWCLDPIDGTKGFLRGRVE
GGQYCIALALLEDGEPVLSILGCPNLPLPLNQSSKSSRGSLFVAIRGCGCYEKALHTNDD
EAAAMWNQLHVTRNDGSIKTPSQSTFCLGVERGFSDPKGTVLKMAQHIDGDDAITTDAEG
VPDINNSMRLDGQGKYGLLARGDAEYFVRLPKDGYVDWIWDVAAGYLILKEAGGIMTDVH
GNCI
NT seq 914 nt NT seq  +upstreamnt  +downstreamnt
ctatccaaaaaggatgcttctcccgtaactattggagattttgcctcccaagcattagct
ttgcaattgttattcaatcgctttccaaatgatatgtacattgccgaggaagggagtgag
gcattgcggctagatgaagagttgttggaacgagtttggaaggcagtcaattctgcttgg
tcttcgttagatagcgacaacaatgtttggtatgaaagaggggagttactacgagctatt
gattacggccaaggaaaaggaatgccggtagtaagtgctactgctacaacaagacgaaga
agagtgtggtgcctcgatccaattgacggtacaaaaggcttcttacgtggtcgagtcgaa
ggagggcaatactgcattgcgttggcattgcttgaagatggagagcctgttctatcaatt
ctcggatgtccaaatctaccacttccgttgaatcaaagcagcaagagttcaagagggagt
ctcttcgtagcaattcgcggatgtggatgctacgaaaaggcactgcataccaatgatgac
gaagcagcagcaatgtggaatcaattgcatgtaactcgaaacgatggatcaatcaagacg
ccttcacaatctacattctgccttggggtggagcgcggcttctcagatccaaagggtaca
gtcctaaaaatggcacagcatattgatggagatgatgctattacaaccgatgcagaagga
gtgccagacattaacaactcaatgagattggacgggcagggaaagtatggtttattagct
cgaggagatgcggaatactttgtccggctgcccaaggatggatacgttgattggatatgg
gacgttgctgcggggtacttgatattgaaagaagcaggaggcataatgactgatgtgcat
ggtaattgtattaa

DBGET integrated database retrieval system