KEGG   Thalassiosira pseudonana: THAPSDRAFT_263722Help
Entry
THAPSDRAFT_263722 CDS       T01078                                 

Definition
bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tps  Thalassiosira pseudonana
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    THAPSDRAFT_263722
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     THAPSDRAFT_263722
Transfer RNA biogenesis [BR:tps03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    THAPSDRAFT_263722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 304 aa AA seqDB search
LSKKDASPVTIGDFASQALALQLLFNRFPNDMYIAEEGSEALRLDEELLERVWKAVNSAW
SSLDSDNNVWYERGELLRAIDYGQGKGMPVVSATATTRRRRVWCLDPIDGTKGFLRGRVE
GGQYCIALALLEDGEPVLSILGCPNLPLPLNQSSKSSRGSLFVAIRGCGCYEKALHTNDD
EAAAMWNQLHVTRNDGSIKTPSQSTFCLGVERGFSDPKGTVLKMAQHIDGDDAITTDAEG
VPDINNSMRLDGQGKYGLLARGDAEYFVRLPKDGYVDWIWDVAAGYLILKEAGGIMTDVH
GNCI
NT seq 914 nt NT seq  +upstreamnt  +downstreamnt
ctatccaaaaaggatgcttctcccgtaactattggagattttgcctcccaagcattagct
ttgcaattgttattcaatcgctttccaaatgatatgtacattgccgaggaagggagtgag
gcattgcggctagatgaagagttgttggaacgagtttggaaggcagtcaattctgcttgg
tcttcgttagatagcgacaacaatgtttggtatgaaagaggggagttactacgagctatt
gattacggccaaggaaaaggaatgccggtagtaagtgctactgctacaacaagacgaaga
agagtgtggtgcctcgatccaattgacggtacaaaaggcttcttacgtggtcgagtcgaa
ggagggcaatactgcattgcgttggcattgcttgaagatggagagcctgttctatcaatt
ctcggatgtccaaatctaccacttccgttgaatcaaagcagcaagagttcaagagggagt
ctcttcgtagcaattcgcggatgtggatgctacgaaaaggcactgcataccaatgatgac
gaagcagcagcaatgtggaatcaattgcatgtaactcgaaacgatggatcaatcaagacg
ccttcacaatctacattctgccttggggtggagcgcggcttctcagatccaaagggtaca
gtcctaaaaatggcacagcatattgatggagatgatgctattacaaccgatgcagaagga
gtgccagacattaacaactcaatgagattggacgggcagggaaagtatggtttattagct
cgaggagatgcggaatactttgtccggctgcccaaggatggatacgttgattggatatgg
gacgttgctgcggggtacttgatattgaaagaagcaggaggcataatgactgatgtgcat
ggtaattgtattaa

DBGET integrated database retrieval system