KEGG   Thalassiosira pseudonana: THAPSDRAFT_263906Help
Entry
THAPSDRAFT_263906 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tps  Thalassiosira pseudonana
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    THAPSDRAFT_263906
  Metabolism of other amino acids
   00480 Glutathione metabolism
    THAPSDRAFT_263906
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     THAPSDRAFT_263906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 106 aa AA seqDB search
LYSLSAKDANGKLLSMESFEGYVTVIVNAARVCDYSEVFYGTLEHMHSVYPYALEILAFP
FNHPNVTIDKCEDAIKSAEKSGGTKVHIMEAIDINGDSTHPVFKYL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
ctgtactctttgtcggcaaaagatgcgaacggcaagttgttatcaatggagagctttgag
ggatatgttactgtcattgtgaacgcggctagagtatgtgactacagtgaagtcttttac
ggcactctcgagcatatgcactctgtgtatccgtatgctttggagatacttgctttcccc
tttaatcacccaaatgttacaattgacaaatgtgaggatgcaatcaaatcggccgagaaa
agtggaggcacaaaagttcatatcatggaggcaatcgacatcaatggcgacagcacacat
cccgtattcaaatatctg

DBGET integrated database retrieval system