KEGG   Thalassiosira pseudonana: THAPSDRAFT_263931Help
Entry
THAPSDRAFT_263931 CDS       T01078                                 

Definition
(RefSeq) ubiquitin carboxyl terminal hydrolase
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     THAPSDRAFT_263931
Peptidases [BR:tps01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   THAPSDRAFT_263931
Ubiquitin system [BR:tps04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    THAPSDRAFT_263931
  UBL-specific proteases (ULPs)
   THAPSDRAFT_263931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12 Glyco_hydro_65N SQHop_cyclase_C
Motif
Other DBs
NCBI-GeneID: 7443181
NCBI-ProteinID: XP_002293254
JGI: 263931
UniProt: B8CAN7
Position
12
AA seq 233 aa AA seqDB search
KEKLWFPLESNPALLNEYISNLGFSTDSHQFVDVFSTESWALDMIAQPVVAVVALFPMTE
KVSKRRKELHAESVRDTNVDGVWYVKQRIRNACGTIAVLHALANIPQSTQEVIKCPSWLQ
TYLLSSPTSSSPIDKADVLENDATIELFHGAATNHTINSTSRGNKEDEIDMHFITFTHVD
GRLYELDGRLEQGPIDHGSTTQANLLKDACGVLQQLMEADLDEVRFTILALAP
NT seq 698 nt NT seq  +upstreamnt  +downstreamnt
aaagaaaagctatggttccctctagaatccaacccagcccttctcaacgaatacatctcc
aaccttggcttctccaccgatagccatcagttcgtggacgtattcagcacagaatcttgg
gcgctggatatgattgcacaaccggtcgtggcggtggtggcgttatttccgatgacggag
aaggtatctaaaaggagaaaagagctgcatgccgagtctgttagggatacgaatgtggat
ggagtttggtatgtgaagcaaagaattaggaatgcctgtggaactattgccgtcttgcat
gcccttgcaaatataccgcagtctacacaagaagttatcaagtgtccttcgtggcttcaa
acctacctcctttcctctccaacgtcctcctcaccaattgacaaagcagatgtactagaa
aacgatgcaaccattgaattgtttcacggagcagccaccaaccacaccattaactcaaca
tctcgtggaaacaaagaggacgaaatagacatgcacttcataacattcactcacgtcgac
ggaaggctgtacgaattggatggtagattggagcagggaccgattgaccacgggagcacg
acacaggctaatttgttgaaggacgcgtgcggtgttttacaacagttgatggaggctgat
ttggatgaagttagatttactattttggcgttggctcc

DBGET integrated database retrieval system