KEGG   Thalassiosira pseudonana: THAPSDRAFT_263945Help
Entry
THAPSDRAFT_263945 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    THAPSDRAFT_263945
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     THAPSDRAFT_263945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 677 aa AA seqDB search
LFNAGSGSFIGMFSCFTNDASLITVRNNRVQGAVLLKISSCTFESIVSKYPRVLIHCLLD
IVDTIGDGPSLCVSSPMFLLDWCLDWMHVEAGEYIATKGEQCDSMFVVLNGRLRVGSSKS
SSKESHKEFGRGATIGELEALADGHWSHSVYASRHCEVARIPMSLLNILMTLYPTSGIHF
AKVIARLQNKGTKTKEFTPTLLPSYALSLATIAVVPLTPEVNLSEFCSSLTNSLRDIAPT
KLLTKRETMERVGEGLFKHKNKLLNVKMTRILGDIEENNRLVVYEAEMKYTWWTKISIQQ
ADLVLVVVDSANAPDILRVEPCLAWAKEVKNIRIELVVVQSTLSQEVSNSDEHASDNLNN
WSEQRLWISKHHLIRQPFADHLNDFRRMCRRVTGQSIGLVLGGGGARGLAHLGVIRALNE
MGVAVDMVGGTSQGAFVGALFAKNPDNYDDLEKTLREMAVNMSSIKEKLLDLTFPLTSFF
NGSRFNKGIQKFLGDIRIQDLVLNFFCVSVDIRNSRQMVHTKGLAWKYVRASMGLTGYLP
PISENNSLLVDGGYMNVVPADVMSEAGAKKIIAVDVSKEAASDYYEYGTELSGLWLLWNS
WNPFVQTVKVPSMGDINERLAWVSSERLLKDVVAKKVDLFLKPPVQDYGVLEFDKFDELV
QIGYDYAKPLVEQWASE
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
cttttcaatgctggctcgggatcgtttattggtatgttctcgtgcttcaccaacgatgca
agtttgattacggtccgcaacaacagagtccaaggtgcagtgttgctcaagatatcatca
tgtacatttgaaagcatcgtatccaaatatccacgtgtgttgatacactgtcttttggat
atcgttgacacaatcggtgatggcccaagcctttgcgtatcatctccaatgtttctgtta
gactggtgcttggactggatgcacgttgaggccggggagtacattgcaacaaaaggagag
cagtgcgattccatgtttgtcgttttgaatggtcgtcttcgcgtgggatcgtctaagtca
tcttctaaagaaagtcacaaggaatttgggaggggagcaacaattggggagctggaagcc
ttggcggatgggcattggtctcatagcgtatatgctagtcgtcattgcgaagttgcgagg
attccgatgagtttgttgaatattctcatgacactctatccaacgtcaggtattcacttt
gctaaagtgatcgcaaggcttcagaataagggaacgaaaacgaaggagttcacaccgacg
cttttgccgagctatgctttatcacttgcaaccatagcggttgtgcctctcactccggaa
gtgaacttatctgagttttgctcctcattgactaactctttacgtgacatcgcaccaact
aagctgctcaccaaaagagagacgatggagagagttggtgaggggctattcaagcacaag
aataaattgttgaatgtcaagatgacgaggatactgggagatatcgaggagaataaccgt
ttggttgtgtacgaggcagagatgaagtatacatggtggacaaagatctccattcagcag
gccgatctcgttttggtcgttgtagactctgccaatgcaccagatatacttcgtgttgaa
ccatgtctagcttgggcaaaagaagtgaagaatattcgcattgagttggtcgttgtgcaa
tctactttgtcgcaggaagtctccaactcggacgaacacgctagtgacaatctcaacaat
tggagtgaacagagactttggatttcaaagcatcacttgatacgacagccatttgcagat
cacttgaacgattttagaagaatgtgcagacgtgtcaccggtcagagtatcgggcttgta
ctcggtggtggtggagcccgaggtttggctcatctaggtgtgatacgagctctcaacgag
atgggagttgccgttgacatggttggaggcactagccaaggggcgtttgttggagctttg
tttgcaaagaatcctgacaattacgatgatctcgagaaaacattacgagaaatggcagtg
aacatgtctagtatcaaggagaaactacttgacttgacgtttcccttgacgagcttcttc
aacggttccaggttcaataaaggaatacagaagtttcttggtgatatccgcattcaagat
ttagtcctgaacttcttttgcgttagtgtggatatcagaaactctcgacagatggtgcac
acaaaaggtctcgcttggaagtacgttagagcatcaatgggcttaactggataccttcca
ccgataagcgagaacaactcactcctcgttgacggaggttacatgaacgtggttcccgct
gacgtcatgtcggaggcaggtgcgaagaagatcattgccgttgatgtcagcaaagaggct
gcttctgattactacgagtatggaaccgagctatcaggactttggttgctttggaacagt
tggaatcctttcgtgcagaccgtgaaagtaccttccatgggtgatataaacgaacgatta
gcatgggtgtcgtcggaacgtttgctcaaagatgttgtggcgaagaaggttgatttgttt
ctcaaaccacccgtacaggactatggcgtccttgagtttgataagttcgacgaactagtg
cagattgggtatgattacgcgaaaccacttgttgagcagtgggcatctgag

DBGET integrated database retrieval system