KEGG   Thalassiosira pseudonana: THAPSDRAFT_264678Help
Entry
THAPSDRAFT_264678 CDS       T01078                                 

Definition
NAD or nadp-dependent reductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     THAPSDRAFT_264678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 616 aa AA seqDB search
GGHLTIYYGSQTGTAQMFAKQIASEAESHGFCSRVVDLQDVVENEDDAATRSKAIFFVAT
YGEGEPTDNAQQFWIDSISLDESATLDATLRDMYFLNDLDYCVFGLGNKQYEHYNNMGRF
MDAALQKCGGSRIAPIGLGDDDDDLEGDFETWKDSVLWPALKERYVKEEDALAAAAVSAA
ATLPSCPYRVEYLTNGSAGQVASQDTIQTSSKHYSLSVDCPVVTRRELRDPSDPGSTVHM
EIDISKHMDVMKYQTADNLGVLPKNDSSIVEAVASALKYDLDQRFTLQPNTQSDEAASTK
HTLPFPTPCTVRECLTRYCDLSGPPRRSDLKQFAPYARDEIDRKALLRMSSKEGKAEYKE
KIVEAHVGIADIVTKLCPSIVCPLEHFIMVCPRLQPRYYTISSSSTVHPKTIHITFAVLE
TAKKDGGKFKGLCSGHLEGVPKGDVVRVFVRDSTFRLPKQVERPVILIGPGTGIAPMRAI
LQERSHIRKTGGKEKHGANILYFGCKQRNLDYIYSDELESFQEEGTLSELHLAFSREQDH
KVYVQHLLAKQSAETWRLIHDEKASIFVCGAVQMGADVDHTLQAIISEHGEMSREKAKAY
LNKLALAGRFVNELWS
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
gggggacacttgaccatctactacggatcccaaaccggaaccgcccaaatgttcgccaag
caaatcgcatccgaggcggaatctcacgggttttgcagccgagtggtggacttgcaggat
gtcgttgaaaacgaggacgatgcggccactagatccaaagccatcttcttcgtagccacc
tatggtgaaggagaacccactgataatgcacaacagttttggattgacagcattagcttg
gatgagagtgccactcttgatgctacattgagagatatgtactttttgaatgacttggac
tattgtgtgtttggtctggggaataagcagtatgagcattacaataacatggggaggttt
atggatgcagccttgcaaaaatgcggagggtcgaggattgctcctatcgggttgggagac
gatgatgatgatttggagggagattttgaaacgtggaaggatagtgtgttgtggcctgcg
ttgaaagaacggtatgtgaaggaggaggatgctttggcggcggctgctgtttcagctgct
gctacgttgccatcgtgtccatatcgcgtggaatatctgacaaatggaagtgcgggacaa
gttgcttcgcaggatacgattcagacttcatccaagcattattcgctttccgtggactgc
ccagttgtgacacgtagagagttgcgtgacccttctgatcctgggtcgactgtacacatg
gagattgacatttcaaagcacatggacgtgatgaagtatcagactgctgacaacttgggt
gtgcttccgaagaatgactcttccatcgtcgaggctgtcgccagtgctctcaaatatgat
ttggatcaacgttttactctccaacccaacactcagagtgacgaagctgcatcaaccaaa
cacacacttccatttccaactccctgcactgtccgtgaatgtctaactcggtactgtgac
ctctctggtcctcctcgtcgatctgacctcaaacaatttgcaccctacgcgcgtgacgaa
attgatcgaaaggcactgctacgaatgtcctccaaagaaggcaaggcagaatacaaggag
aaaattgttgaagcgcacgtgggcattgctgatatcgttacgaaactctgcccttccatc
gtttgtccattggagcacttcattatggtatgtccacgattgcaaccacggtattatacc
atttcatcttcgtcaacggtgcatcccaagacgattcatatcactttcgctgtattggag
acggcaaagaaagacggagggaagttcaaaggattgtgctctgggcatttggagggcgtg
ccaaagggtgatgtggtccgtgtgttcgtgagagattcaacctttcgcttgccaaagcag
gtggaacgacctgttatactcattggaccaggcacgggtatcgctcccatgcgagccatt
ttgcaggagcgatcgcatattcgcaagacgggagggaaagagaagcacggtgccaacatt
ctttactttggatgcaaacagaggaacttggactacatctatagcgacgagttggaatca
tttcaggaggaaggtactctgtcggagcttcacttggcattctctcgcgagcaagatcac
aaagtgtacgtgcaacatttgctggcgaaacagtctgctgagacttggaggttgattcat
gatgaaaaggcgtcgatattcgtttgtggagctgtccagatgggcgcggatgttgatcat
accttgcaagctatcatctcggagcatggggaaatgagcagagagaaggcaaaggcgtat
ttaaataagctggcattggcaggtagattcgtcaatgagttatggtcgtga

DBGET integrated database retrieval system