KEGG   Thalassiosira pseudonana: THAPSDRAFT_264854Help
Entry
THAPSDRAFT_264854 CDS       T01078                                 

Definition
dual-specificity tyrosine-phosphorylation regulated kinase 1a-like protein (EC:2.7.1.-)
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     THAPSDRAFT_264854
Protein kinases [BR:tps01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   THAPSDRAFT_264854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
22
AA seq 420 aa AA seqDB search
PQVTLAAGQVPPTIGRLPADRPIIKLSVSLIETYKEINKVPRRAARRAAQQPSSQQDPNA
QGAGRGPNNGGYDDENYDYIFTPNEVINDRYVLQKRIGKGSFGQVVQALDKKTDKEVAIK
IIKSKRPFLMQAKTEIALLTTLNDNDREDQNNIVQLLTTFIYRNHQCLVFEMLSLNLYEL
LKNTNFAGVSLNLIRKFAKQILKALSFLARPEIDIIHCDLKPENILLRHPKRSGIKVIDF
GSSCKSSKRMYSYIQSRFYRSPEVMLGLPYTVAIDMWSLGCILVEMHTGEPLFSGTDQFD
QMQKIVAILGMIPDQMLLSAEADKRNQFFEQSRGRWNIKQTSDATTSATSFTPITPSLNP
IASLKDVVGKDAQRKKKFAPSEDPQQAALSYERFVDLILKMLAFKPEDRLSPENALEHPF
NT seq 1262 nt NT seq  +upstreamnt  +downstreamnt
cctcaagttacattggccgcaggtcaagttcctccgacgattgggaggttgcctgctgat
agaccgattatcaaactaagtgttagtctgatagagacttacaaggagatcaacaaggta
ccacgccgagcagctcgtagagcagcacaacaaccatcttctcagcaagatccaaatgca
caaggtgcaggtcgtggtccaaacaatggaggttacgacgacgaaaactacgactacatc
tttacaccgaatgaagtaatcaatgatagatacgtccttcagaaacgaatagggaagggg
tcatttggtcaggtggttcaagctttggataagaagacggacaaggaggtggccatcaag
attatcaagagtaagcggccattcttgatgcaggccaagacggagattgcattgctgact
acgctgaatgacaacgatagagaggatcagaacaatatcgtccaactccttacaacattc
atttaccgaaatcatcaatgtctcgtctttgagatgctctctcttaatctctacgagctt
ctcaaaaacacaaacttcgcaggagtatccctgaatctgatacgcaagttcgccaaacaa
atactcaaggcattatccttcctcgcccgtccagaaatcgatataatacattgcgactta
aagcctgagaatatattgctgaggcacccaaaacgaagcgggattaaggttattgacttt
ggaagctcgtgcaagtcgagcaagagaatgtattcgtacatccagagtcggttttatcgt
agccccgaggtgatgctgggtctaccgtacactgtggctattgatatgtggagtctgggt
tgtatactcgtagagatgcatactggagagccgttgttttcaggaacggatcagtttgat
cagatgcaaaagatcgttgcgatattaggaatgattccagatcagatgctcctttcagcc
gaagcagacaagcgaaaccagttcttcgaacaaagcagaggaagatggaacatcaaacaa
acatccgacgctaccacatccgccacttcattcacaccgattactccgagcttaaatccc
atcgcatctttgaaggatgtggtgggaaaagatgctcaacgaaagaaaaagttcgctcct
tcggaagacccccaacaggcggctttgtcgtatgagagatttgtagatctgatacttaag
atgttggcgttcaaaccagaggatagactgagtcctgagaatgctctggaacatcctttc
at

DBGET integrated database retrieval system