KEGG   Thalassiosira pseudonana: THAPSDRAFT_264891Help
Entry
THAPSDRAFT_264891 CDS       T01078                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tps  Thalassiosira pseudonana
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    THAPSDRAFT_264891
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    THAPSDRAFT_264891
Enzymes [BR:tps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     THAPSDRAFT_264891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
23
AA seq 764 aa AA seqDB search
MLSPFPPSLKMNHTPIKMKTSGYQAIPEEAEGEQPMELSRQESSNNSSGSDDGDGSNAKR
NMLMVALSLFLLCVAYSAGRSSSTSGGIGGGISNGKGKLSILPQDVNIQNEIPSRLCEVY
YDPHQASRDVTVIQTSRAEPSRSPILGFGGAFTEAAALNYMSLNEEGREMVMQLLFGREG
LGYSLGRTHINSCDFCIKSYSFDDTPDDFSLSSFDTLVSHDLNVGMVDMMLLATKTYTES
HPKEIEQHHTMRIIASPWSPPSWMKAPTESDVKGADGVGEDSKYAKAWALFFSKFIDAYA
NHGIDFFGVTVQNEPEFPAPWDACAFDAKSQRDFIANHLGPRLAKSNPNTKLLIFDHNKD
HMVDWARALLEEDNPAAKYIDGTAFHWYAGMPNMHRMVSELDTMKVDKSHILLGSEACHC
PTTGYAGGDLDIAWARAMRNAHTVLADMASGSNGFIEWNLILDSIGGPNHLGNMCDSPLL
ALNAEGVSAKYLDVGIVVQPMYYYMGHITRFVRPGSRAIHALVDSSIGSPEARTFRPKGQ
TVAGGGINDLARIGIEVTLWPCEGSTRQEWTYNSDNQLQVFGHDWLGVPTTSCLAEKSDK
DMGGLMLTTCNVTESKAGLYDVIPVDDKSDRVNIVMKKSKVDAKKSCLVVQPLRNNGGAY
GPRGGGQINVGDCSHSWAEWTFDTTTGEISSMAFEEVGGEVCVTTGWPFLQVGAFDTSST
GDKANAVVVLNEAGEAANFILRNDGVEIMSSSIPPHSIQTISFN
NT seq 2293 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccccttccccccttccctaaaaatgaaccacaccccgatcaagatgaagacg
agcggatatcaagccatacccgaagaagcagagggtgaacagcctatggaactctctcgc
caagagagcagcaacaacagtagcggcagtgacgacggagatggatctaatgccaagcgt
aacatgttgatggttgcactctccctgtttcttctctgtgtcgcctattctgccggccgc
tcctcctccacttctggtggaatcggcggcggtatcagtaatgggaaaggcaagttatca
atcttaccacaagatgtaaacatccaaaacgagattccatcacgattgtgcgaggtgtat
tatgatcctcatcaagcaagcagagatgtgacggtgatccagaccagtagggccgagccg
agtagaagtccaattctaggatttggaggagcatttaccgaggcggctgctttgaattac
atgagtttgaacgaagaggggagagagatggttatgcagttgttatttgggagggaggga
ttgggttatagtctcggaagaacgcacatcaactcctgcgacttctgcatcaaatcctac
tctttcgacgacacccccgatgacttttcactgtcctccttcgacacactcgtctctcac
gatctcaacgttggcatggtagacatgatgctccttgctaccaaaacgtatactgaatct
caccctaaggagattgaacagcatcatacaatgaggataattgcttctccttggagtccg
ccgagttggatgaaggcaccgacggagagtgatgtgaagggagcggatggggttggagag
gattcgaagtacgcaaaggcgtgggctttgttctttagcaagtttattgatgcttacgcc
aatcacggtatcgacttcttcggagtcaccgtccaaaacgaaccagagttcccagctccg
tgggatgcctgtgcctttgatgccaaatctcaacgagacttcattgccaatcacttagga
cctcgtcttgccaaatcaaatccaaacacaaaactgttgatatttgatcacaacaaagat
cacatggtggattgggcacgtgccttattagaagaggacaatcccgcagcaaagtatatt
gacggcacggcatttcattggtatgcagggatgcccaatatgcatcgcatggtctcagag
ttggatacgatgaaagtggataagagtcatatattgttgggatcggaggcatgtcattgt
cctactactggatatgcgggtggtgatttggatattgcttgggcaagggctatgaggaat
gctcatacggtattggcagatatggcatcgggtagcaatggttttattgaatggaatctg
attctggactccatcggagggcccaaccaccttggaaacatgtgtgactctcctctttta
gcattgaatgccgaaggagtatctgccaaatatcttgatgttgggattgtcgttcaaccg
atgtactattacatgggacacattactcggtttgttcgtccaggatctcgtgctattcat
gcacttgtggatagcagtattggcagtccagaggcacgaaccttccgtcctaaagggcag
actgttgctggaggtggaattaatgatctcgcacggattggaattgaagtgacactttgg
ccgtgtgaaggatcgacgagacaagagtggacatataactcagataatcagttgcaagtg
tttggacacgattggctaggagtaccaacaacctcatgtttggcagagaaatctgacaag
gatatgggaggactcatgctgacaacttgtaacgttactgagagcaaagctggattgtac
gacgtaatcccggttgatgacaagtcggatagagtgaatattgttatgaagaaaagcaaa
gtcgatgccaagaagagttgccttgttgttcaaccattgaggaacaatggtggagcttac
gggccaaggggaggaggtcaaataaacgtcggtgactgttctcattcatgggctgaatgg
acgtttgatacaacgactggagagatatcatctatggcatttgaagaggttggaggtgaa
gtctgtgtaactactggttggccttttctccaagttggagcctttgatacatcttcaact
ggagacaaagccaatgcggttgtcgttttgaacgaagcaggcgaggcagcgaatttcatc
ttgcgaaacgatggggttgaaatcatgtcgtcgtccattccaccgcattctattcaaaca
atctcattcaatt

DBGET integrated database retrieval system