KEGG   Thalassiosira pseudonana: THAPSDRAFT_264901Help
Entry
THAPSDRAFT_264901 CDS       T01078                                 

Gene name
Ppx1
Definition
protoporphyrinogen IX oxidase usually abbreviated (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tps  Thalassiosira pseudonana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tps00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
23
AA seq 502 aa AA seqDB search
DCLVIGGGISGSTLAHNLHSTHSLNILLAEARDYLGGNVQSVQHTDDDGTFIYEKGPNSF
ATQPSIVRISHELGIEEELVFADESLPPWVNHNGKLHPLPKGKGGKGPKGQIELFGLAGD
LLSWPGKIRAGIGAFVGHPAPPTDREETIQDWVTRILGEEVFYRIIDPFVSGVYAGDPNT
LSMKAALPKISRIEQYSYDIDWNKFGAIFYGGLARQVELTKERKADPPDANWVDFEYGNP
GSYKKGLSTLPNAIKEELGEKVKLEWSLKKVEKVDGGYVATFDTPNGEEKVNAKTVVSTM
PTHAIGSILEPVLPGSTDLFSQKGIYYPPVAAVTLAYPKSAFKDVELDNEFGNLKDLPGF
GSLNPRTEGVRTLGTLWSSSLFPERCPSDYNILLNYIGGSRDPAIGTMEEKDIIDAVDID
LRKVLLDSTAPPPKVLGLKVWPTAIPQYELGHLEILQELEAMEKKVEGGGIWICGNYRSG
VAFPDCVTFGYEHAQVVKDYLD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gactgcctcgtcatcggaggaggcatctccggctccaccctcgcccacaacctccactcc
acacactcgctcaacatcctcctcgccgaagcacgggactacctcggcggcaacgtccaa
agcgtacaacacaccgacgacgacggaacgttcatctacgaaaagggtccgaatagcttt
gccacgcagccttccatcgtgcggatttcgcacgaacttggtattgaggaggaattggta
tttgccgacgagagtttaccgccgtgggtgaatcataacggaaagctgcatccacttccc
aaggggaagggggggaagggacccaaaggacagattgaattgtttggattggcgggggat
ttgttatcgtggccggggaagattcgggcggggattggtgccttcgttggtcatcctgct
cctccgacggatagagaggagacgattcaagattgggtgacgcgtattttgggcgaggag
gttttttataggattattgacccgtttgtgagtggagtgtacgctggagatccgaatacc
ttgagtatgaaggcggctcttccaaagatttcacgtattgagcagtattcgtatgatatt
gattggaataagtttggggcgatattctatggggggttggctcgtcaagtggagttgacg
aaggagaggaaggctgatccaccggatgccaattgggttgactttgagtatggaaatccg
ggaagttataagaagggtttgagtacgttgcccaatgccatcaaggaggagttgggagaa
aaagtcaagttggaatggagtttgaagaaagttgagaaggtggatggtgggtatgttgcc
acttttgatactccaaacggtgaagagaaggtgaatgccaagacggtggttagtaccatg
cccactcacgccataggatcgatattggaaccagttcttcctggatctaccgatttgttc
tcccaaaagggaatctactaccctcccgtggcagctgtgactttggcatatccaaagtca
gcctttaaagatgtggaacttgacaatgaattcggtaatctcaaggatttgcctgggttt
ggaagtctcaatcctcgtacggagggagtgcgtactttgggaacgttgtggtcgtcgtct
ctctttcctgaaaggtgtccttcggactacaacattttgttgaactacattggtggaagt
cgtgatcctgccattggaactatggaagagaaggatatcattgatgcggtggatattgat
ctgcgtaaggtcttgttggactcgactgcacctcctccgaaagtgttgggattgaaggtg
tggccgactgccattcctcaatatgagctcggacacttggaaattttgcaagagttggaa
gcgatggagaagaaggtagagggtggtggtatctggatttgtggtaactacaggagtggc
gttgcctttcctgattgtgtcacatttggatacgagcatgcccaggttgtgaaggactac
ttggat

DBGET integrated database retrieval system