KEGG   Thalassiosira pseudonana: THAPSDRAFT_264901Help
Entry
THAPSDRAFT_264901 CDS       T01078                                 

Gene name
Ppx1
Definition
protoporphyrinogen IX oxidase usually abbreviated (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tps  Thalassiosira pseudonana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THAPSDRAFT_264901 (Ppx1)
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     THAPSDRAFT_264901 (Ppx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
23
AA seq 502 aa AA seqDB search
DCLVIGGGISGSTLAHNLHSTHSLNILLAEARDYLGGNVQSVQHTDDDGTFIYEKGPNSF
ATQPSIVRISHELGIEEELVFADESLPPWVNHNGKLHPLPKGKGGKGPKGQIELFGLAGD
LLSWPGKIRAGIGAFVGHPAPPTDREETIQDWVTRILGEEVFYRIIDPFVSGVYAGDPNT
LSMKAALPKISRIEQYSYDIDWNKFGAIFYGGLARQVELTKERKADPPDANWVDFEYGNP
GSYKKGLSTLPNAIKEELGEKVKLEWSLKKVEKVDGGYVATFDTPNGEEKVNAKTVVSTM
PTHAIGSILEPVLPGSTDLFSQKGIYYPPVAAVTLAYPKSAFKDVELDNEFGNLKDLPGF
GSLNPRTEGVRTLGTLWSSSLFPERCPSDYNILLNYIGGSRDPAIGTMEEKDIIDAVDID
LRKVLLDSTAPPPKVLGLKVWPTAIPQYELGHLEILQELEAMEKKVEGGGIWICGNYRSG
VAFPDCVTFGYEHAQVVKDYLD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gactgcctcgtcatcggaggaggcatctccggctccaccctcgcccacaacctccactcc
acacactcgctcaacatcctcctcgccgaagcacgggactacctcggcggcaacgtccaa
agcgtacaacacaccgacgacgacggaacgttcatctacgaaaagggtccgaatagcttt
gccacgcagccttccatcgtgcggatttcgcacgaacttggtattgaggaggaattggta
tttgccgacgagagtttaccgccgtgggtgaatcataacggaaagctgcatccacttccc
aaggggaagggggggaagggacccaaaggacagattgaattgtttggattggcgggggat
ttgttatcgtggccggggaagattcgggcggggattggtgccttcgttggtcatcctgct
cctccgacggatagagaggagacgattcaagattgggtgacgcgtattttgggcgaggag
gttttttataggattattgacccgtttgtgagtggagtgtacgctggagatccgaatacc
ttgagtatgaaggcggctcttccaaagatttcacgtattgagcagtattcgtatgatatt
gattggaataagtttggggcgatattctatggggggttggctcgtcaagtggagttgacg
aaggagaggaaggctgatccaccggatgccaattgggttgactttgagtatggaaatccg
ggaagttataagaagggtttgagtacgttgcccaatgccatcaaggaggagttgggagaa
aaagtcaagttggaatggagtttgaagaaagttgagaaggtggatggtgggtatgttgcc
acttttgatactccaaacggtgaagagaaggtgaatgccaagacggtggttagtaccatg
cccactcacgccataggatcgatattggaaccagttcttcctggatctaccgatttgttc
tcccaaaagggaatctactaccctcccgtggcagctgtgactttggcatatccaaagtca
gcctttaaagatgtggaacttgacaatgaattcggtaatctcaaggatttgcctgggttt
ggaagtctcaatcctcgtacggagggagtgcgtactttgggaacgttgtggtcgtcgtct
ctctttcctgaaaggtgtccttcggactacaacattttgttgaactacattggtggaagt
cgtgatcctgccattggaactatggaagagaaggatatcattgatgcggtggatattgat
ctgcgtaaggtcttgttggactcgactgcacctcctccgaaagtgttgggattgaaggtg
tggccgactgccattcctcaatatgagctcggacacttggaaattttgcaagagttggaa
gcgatggagaagaaggtagagggtggtggtatctggatttgtggtaactacaggagtggc
gttgcctttcctgattgtgtcacatttggatacgagcatgcccaggttgtgaaggactac
ttggat

DBGET integrated database retrieval system