KEGG   Thalassiosira pseudonana: THAPSDRAFT_26536Help
Entry
THAPSDRAFT_26536  CDS       T01078                                 

Gene name
SNF1
Definition
sucrose non-fermenting (SNF-1) related serine threonine protein kinase (EC:2.7.1.-)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tps  Thalassiosira pseudonana
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:tps04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 553 aa AA seqDB search
MEQPPVQIGQYVLGKNLGIGAFGKVKLATHAITGHKVAVKILNKAKIKQLGMEEKVQREI
NILHLCTHPHIIRLYEVIDTPTDIFLVNEYVSGGELFDYIVSKGRLSADEARNFFHQIIS
GVEYCHFQKIVHRDLKPENLLLDSNLNIKIADFGLSNLMRDGDFLRTSCGSPNYAAPEVI
SGHLYAGPEVDVWSCGVILYALLCGSLPFDDESIPNLFKKIKSGMYSLPSHLSQLARNLI
PRMLEVDPMKRITIPEIRLHPWFQHKLPPYLRHPPELMEKQERVVDPAVIDELVESAASL
EDSREDGAPKVLRDLRVAYELILDHKHTRLRVMEVARAIREAASATPPAFSPGGSRGATP
GGYPGSASSGPGSFGGSFDARFQNRRWYLGIQSKKDPAHVMTEVYKALMALGCEWLQLSS
YRIKCRWRPNMNIDDEGKSWGESKTKCMGTNEAVDVPDLSTNEYCIKIGLTLYKVQQSIY
LLDFQKMTGDAFSFMTLCANIITELKTLSAASKQQQALLAQQQAAAAAAQQQAAIAAAGR
QLPLGTPQNHPRK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcctcccgtccagatcgggcaatatgtgctgggaaagaatctgggcatcgga
gcttttggcaaggtcaaactcgctacacatgccatcaccggccacaaggtcgctgtcaag
atcttgaataaagccaagattaagcaacttggcatggaagaaaaggttcaaagagaaata
aacattctccatctctgcacacaccctcacatcattcgtctctatgaggttatcgacaca
cccaccgacatattcctggtgaacgagtacgtttcgggaggggagctatttgactatatc
gtgtccaaaggaaggttgtcagccgatgaagctcgaaacttcttccaccaaatcatttcg
ggagttgaatactgccacttccaaaagattgtccatcgtgatttgaagccggagaatctc
ttgcttgattccaacctcaacattaagattgctgattttggattgtccaacttgatgagg
gatggagactttcttcgcacttcttgcggatcccccaattatgctgccccggaagtgatt
agtgggcacctctatgcagggccggaggtagacgtgtggtcgtgtggggttattctttat
gcgttgctctgtggttctcttccgtttgatgacgagtctattcccaacttattcaagaag
atcaagagtgggatgtacagtctaccctcccatctgtctcagcttgcgaggaatctaatt
ccccgtatgcttgaggtagatccaatgaagaggatcacaattccagagatacgtcttcat
ccgtggtttcagcacaaattgccaccttatcttcgtcatcctcccgaactaatggagaag
caggaacgtgtcgtcgaccctgcggttattgatgaacttgttgaatccgccgcttcactc
gaggacagtcgggaagacggggcaccgaaagtgttgcgggatctacgcgtcgcttatgaa
ctcatcttggatcacaaacacacccgtcttcgtgtgatggaagtggctagggctatcagg
gaagctgcgagtgctacccctcccgcctttagtccgggtggatcgagaggggcgacgccg
gggggatatccgggtagtgcaagcagtggtccggggagctttggggggagctttgatgcc
agatttcagaatcgccggtggtacctaggaattcagagtaaaaaggatcctgctcatgtg
atgacggaagtatacaaagccttgatggcgctagggtgcgagtggcttcagctgtcgtcg
tatcgtatcaaatgcagatggagaccaaatatgaatattgatgatgaggggaaatcatgg
ggtgagagtaagacgaaatgtatgggaacaaacgaagcagtggatgttcctgacttgagt
acaaacgaatactgcatcaagatagggcttacgctgtacaaggtgcagcaaagcatctac
cttctcgactttcagaagatgactggggatgccttctcgttcatgactctttgtgctaac
atcatcaccgagttgaagactttgagtgcggcaagcaagcagcaacaagctcttctggct
caacagcaggcggctgcggcggcagctcaacaacaggcggcaatagcagcagcgggtcgg
cagttgcctttggggacgccccagaatcaccctcgcaaatga

DBGET integrated database retrieval system