KEGG   Thalassiosira pseudonana: THAPSDRAFT_26536Help
Entry
THAPSDRAFT_26536  CDS       T01078                                 

Gene name
SNF1
Definition
sucrose non-fermenting (SNF-1) related serine threonine protein kinase (EC:2.7.1.-)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tps  Thalassiosira pseudonana
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:tps00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    THAPSDRAFT_26536 (SNF1)
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     THAPSDRAFT_26536 (SNF1)
Protein kinases [BR:tps01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   THAPSDRAFT_26536 (SNF1)
Mitochondrial biogenesis [BR:tps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    THAPSDRAFT_26536 (SNF1)
  Mitophagy factors
   Other mitophagy factors
    THAPSDRAFT_26536 (SNF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 553 aa AA seqDB search
MEQPPVQIGQYVLGKNLGIGAFGKVKLATHAITGHKVAVKILNKAKIKQLGMEEKVQREI
NILHLCTHPHIIRLYEVIDTPTDIFLVNEYVSGGELFDYIVSKGRLSADEARNFFHQIIS
GVEYCHFQKIVHRDLKPENLLLDSNLNIKIADFGLSNLMRDGDFLRTSCGSPNYAAPEVI
SGHLYAGPEVDVWSCGVILYALLCGSLPFDDESIPNLFKKIKSGMYSLPSHLSQLARNLI
PRMLEVDPMKRITIPEIRLHPWFQHKLPPYLRHPPELMEKQERVVDPAVIDELVESAASL
EDSREDGAPKVLRDLRVAYELILDHKHTRLRVMEVARAIREAASATPPAFSPGGSRGATP
GGYPGSASSGPGSFGGSFDARFQNRRWYLGIQSKKDPAHVMTEVYKALMALGCEWLQLSS
YRIKCRWRPNMNIDDEGKSWGESKTKCMGTNEAVDVPDLSTNEYCIKIGLTLYKVQQSIY
LLDFQKMTGDAFSFMTLCANIITELKTLSAASKQQQALLAQQQAAAAAAQQQAAIAAAGR
QLPLGTPQNHPRK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcctcccgtccagatcgggcaatatgtgctgggaaagaatctgggcatcgga
gcttttggcaaggtcaaactcgctacacatgccatcaccggccacaaggtcgctgtcaag
atcttgaataaagccaagattaagcaacttggcatggaagaaaaggttcaaagagaaata
aacattctccatctctgcacacaccctcacatcattcgtctctatgaggttatcgacaca
cccaccgacatattcctggtgaacgagtacgtttcgggaggggagctatttgactatatc
gtgtccaaaggaaggttgtcagccgatgaagctcgaaacttcttccaccaaatcatttcg
ggagttgaatactgccacttccaaaagattgtccatcgtgatttgaagccggagaatctc
ttgcttgattccaacctcaacattaagattgctgattttggattgtccaacttgatgagg
gatggagactttcttcgcacttcttgcggatcccccaattatgctgccccggaagtgatt
agtgggcacctctatgcagggccggaggtagacgtgtggtcgtgtggggttattctttat
gcgttgctctgtggttctcttccgtttgatgacgagtctattcccaacttattcaagaag
atcaagagtgggatgtacagtctaccctcccatctgtctcagcttgcgaggaatctaatt
ccccgtatgcttgaggtagatccaatgaagaggatcacaattccagagatacgtcttcat
ccgtggtttcagcacaaattgccaccttatcttcgtcatcctcccgaactaatggagaag
caggaacgtgtcgtcgaccctgcggttattgatgaacttgttgaatccgccgcttcactc
gaggacagtcgggaagacggggcaccgaaagtgttgcgggatctacgcgtcgcttatgaa
ctcatcttggatcacaaacacacccgtcttcgtgtgatggaagtggctagggctatcagg
gaagctgcgagtgctacccctcccgcctttagtccgggtggatcgagaggggcgacgccg
gggggatatccgggtagtgcaagcagtggtccggggagctttggggggagctttgatgcc
agatttcagaatcgccggtggtacctaggaattcagagtaaaaaggatcctgctcatgtg
atgacggaagtatacaaagccttgatggcgctagggtgcgagtggcttcagctgtcgtcg
tatcgtatcaaatgcagatggagaccaaatatgaatattgatgatgaggggaaatcatgg
ggtgagagtaagacgaaatgtatgggaacaaacgaagcagtggatgttcctgacttgagt
acaaacgaatactgcatcaagatagggcttacgctgtacaaggtgcagcaaagcatctac
cttctcgactttcagaagatgactggggatgccttctcgttcatgactctttgtgctaac
atcatcaccgagttgaagactttgagtgcggcaagcaagcagcaacaagctcttctggct
caacagcaggcggctgcggcggcagctcaacaacaggcggcaatagcagcagcgggtcgg
cagttgcctttggggacgccccagaatcaccctcgcaaatga

DBGET integrated database retrieval system