KEGG   Thalassiosira pseudonana: THAPSDRAFT_26573Help
Entry
THAPSDRAFT_26573  CDS       T01078                                 

Gene name
ChlH1
Definition
chelatase of mg-protoporphyrin IX chelatase
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tps00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 1340 aa AA seqDB search
MFTASNAENRRVVPEDVRGRPTMKIVYVVLESQYQSSMTAAAKRINAGSDNMAVECVGYL
LEELRNEDAFEQFKKDVSEANVFIGSLIFVQELAEKVSEVVTPLRDQLDAVLVFPSMPEV
MRLNKVGSFTMKNLGQSKSVVADFMKKKKQEDGSSFEEGMLKLLRTLPKVLKFLPSDKAA
DARTFMMSFQYWLGGSPENLESLLLMVGQDYVGPIKESMKDKEKVVMQEPVLLPDKAIWH
PVAPDIVFETNEKYFQWYNNEFCPDAGIDPKTAPTVGIILQKSHINTKDDTHYVSLISEL
ESRGARVVPIYSGGLDFSGPVEDYFYGTNGKPIVDTIINLTGFALVGGPASQDHKKAASV
LKKLNVPYMCAVPLVFQSFEEWQASELGLHPIQVALQVSLPEIDGAIEPIIYAGREGATG
RSVPLADRVNLLADRAMKWSNLRTKKNEEKKIAITIFSFPPDKGNVGTAAYLDVFDSIKA
VLKQLKKEGYNIGDAPDDKEAIMESVLNDPEARISSPELNVAYRMSTDEYYELTPYAKDL
EENWGPAPGNLNSDGQNLVVYGKQFGNVFIGVQPSFGYEGDPMRLLFAKSASPHHGFAAY
YTYLEKVFNADAVLHFGTHGSLEFMPGKQVGMSGTCYPDRLINSLPSAYLYAANNPSEAT
IAKRRSYSATVSYLTPPAENAGLYKGLKELKELISSYQGLRENEARGPAIINSIVSTAWT
CNLDKDIDDLPNLETFDAKTVDLERRDDIAGKVYSQIMQIESRLLPCGLHTVGVPPSAEE
AIATLVNIAQLDRPEDNIEGIPRVIAASVGREINEVYRGNNQGVLTDVELNEKIVMASRA
AVRALVNQSTDSNGRVKEVKNFFDDVGGFFGSLVGAKKPWTQAIIDAGFPNVSEERLAPV
FAYLEFCLKQVVANNELPGIMELLNGQFLMPAPGGDPIRNPDVLPTGRNMHALDPSSIPT
TAAVEVSEDVVRKLLEKLADENDGAYPESIAFTLWGTDNIKTYGESLAQVLALVGVRPVA
DSLGRVNKVELIPLEKLGRPRIDVVVSCSGVFRDLFINQMNLMDRGIKMAAEADEPLDQN
FVRKHAIEQAAELNVSVREAACRVFSNSAGSYSANVGLAIENGGWEDESQLQEQFLTRKG
FAFNADKPGMMEQQADLFKAALKTVDVTFQNLDSSEISITDVSHYYDSDPTKVVQGLRDD
KRKPMSLMADTTTANAQVRTLSETVRLDARTKLLNPKFYEGMLSTGYEGVREIQKRLRNT
MGWSATAGEVDNFVFEDANDVFINDPEMQQRLLDTNPNAFRDMVTTFLEANGRGYWETSE
ENIERLQELYAEVEDRIEGV
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccgcctccaatgccgaaaaccgtcgtgtcgtacccgaagatgtccgtggacgt
cccaccatgaagatcgtgtacgttgttcttgagtctcaataccaatcttccatgactgcc
gctgccaaacgcatcaatgctggatcggacaacatggccgtggagtgtgttgggtacttg
ttggaagagttgaggaatgaggatgcatttgaacaatttaagaaggatgtcagtgaagct
aatgtctttatcggaagtttgatcttcgtgcaggagttggccgagaaggtttcggaggtt
gtgacgcccttgagagatcagcttgatgctgtgttggtgttcccttccatgcctgaggtt
atgaggttgaataaggttggaagcttcacgatgaagaatcttggacagtccaagagtgtg
gtggctgactttatgaagaagaagaagcaggaggatggatcttcttttgaagagggtatg
ttgaagcttttgaggactcttcccaaggttctcaagttccttcccagtgataaggcggct
gatgctcgcaccttcatgatgtctttccagtactggcttggaggatctcctgagaacttg
gagtctctcctcctcatggttggacaagactacgttggacccatcaaagagagcatgaaa
gacaaagaaaaggtggtcatgcaagaaccagtcctcctcccagacaaggccatctggcac
cccgttgctcctgatattgtcttcgagacgaacgagaaatacttccagtggtacaataat
gaattttgccctgatgctggcatcgaccccaaaactgcacccactgttggaatcatcctt
caaaagtcacacatcaacaccaaggatgacacccactacgtctccttgatctctgagttg
gagagccgtggtgctcgcgttgtgcccatctactctggagggcttgacttttctggacct
gtagaggattacttctacggcaccaacggaaagcccatcgtcgatacgatcatcaacctt
actggattcgctcttgttggaggacctgcctcccaggatcacaagaaggccgcatctgtc
ttgaagaagttgaatgtgccttacatgtgcgctgtgccacttgtgttccagtccttcgag
gagtggcaagcatccgagcttggtctgcatcctatccaagttgcactccaggtctccttg
cccgagattgacggtgccattgagcccatcatttacgctggacgtgaaggtgccactgga
cgtagtgttcctctcgccgaccgtgtcaacttgcttgccgaccgtgcgatgaagtggtcc
aacttgcgcaccaagaagaacgaagagaagaagattgccatcaccattttctctttcccc
cctgacaagggtaacgtcggaaccgctgcttaccttgacgtctttgactccatcaaagct
gttctcaagcagttgaagaaggagggatacaatattggagatgctcccgatgataaggag
gctatcatggagtctgtgttgaatgatcctgaggccaggatcagctctcctgagcttaac
gtcgcctaccgtatgagtaccgatgaatactatgagctcactccctacgccaaggacttg
gaggagaactggggacctgcacctgggaacctcaactctgatggacagaacctcgttgtt
tacggaaagcagtttggaaatgtcttcatcggagtgcagccctctttcggatacgaggga
gatcccatgcgtcttctcttcgcgaagtctgcgagtccccatcacggatttgctgcatac
tacacctacttggagaaggtcttcaacgccgatgcggtccttcactttggaacacatgga
agtcttgagttcatgcctggaaagcaagttggtatgtctggcacatgctaccctgatcgt
cttatcaactcccttccttctgcctacctttacgccgccaacaacccatctgaggctacc
attgctaagaggcgttcgtactctgccactgtgtcctaccttacacctcccgccgagaat
gccggtctttacaagggtcttaaggagttgaaggagcttatctcttcttaccagggactt
cgtgagaatgaagcacgtggacctgccattatcaactccatcgtctccactgcgtggaca
tgtaatcttgataaggatattgatgatctcccaaacttggagaccttcgacgccaagacc
gtagatcttgaacgtcgtgatgatattgctggaaaggtgtactcccagattatgcagatt
gagagtcgtcttctcccatgcggacttcacactgttggagtgccacccagtgcagaagaa
gccatcgctaccctcgtcaacattgctcagcttgatcgtcccgaggacaacattgagggt
attccccgtgtgattgccgcttccgtcggacgtgagatcaacgaggtgtacaggggcaac
aaccagggagtcttgaccgacgtagagctcaatgagaagatcgtcatggcttctcgtgcc
gccgtacgcgcgcttgtgaaccaatccactgattccaatggccgtgttaaggaagtcaag
aacttcttcgatgatgttggtgggttcttcggaagtttggtcggagccaagaagccatgg
actcaagccatcatcgatgccggcttccccaatgtcagtgaggaacgattggcgcctgtc
tttgcttaccttgagttctgcttgaagcaggtcgttgctaacaatgagcttccgggaatc
atggagttgctcaacggtcaattcctcatgcctgctcctggtggagatcctatccgtaac
cctgatgtcctccccactggaaggaacatgcacgcccttgatccatcttccatcccaact
actgctgccgtggaagtgtccgaggacgttgtgaggaagcttctcgagaagcttgccgac
gagaacgacggtgcttatcccgagagtattgccttcacattgtggggaactgacaacatc
aagacctacggagagtctctggcccaagttcttgcactcgttggtgttcgtcccgttgcc
gattctcttggacgagtgaacaaggtcgagcttatccctcttgagaagcttggtcgtcct
cgtatcgatgtcgtcgtttcatgctctggagtcttccgtgatcttttcatcaaccaaatg
aatctgatggatcgtggtatcaagatggcagccgaggctgacgagccacttgaccagaac
ttcgtccgcaagcacgccattgagcaagctgccgagctcaatgtctctgttcgtgaggct
gcttgtcgtgtgttctccaactctgccggatcctacagtgccaacgttggacttgctatt
gagaatgggggatgggaagacgagagccagcttcaggagcagttcctcactcgtaaggga
tttgcttttaacgctgacaagcccggcatgatggaacagcaggctgatcttttcaaggcc
gccttgaagacggtcgatgtcaccttccagaacttagactcttctgaaatctccatcact
gatgtctctcactactacgactctgatcctacgaaggttgtgcagggactccgtgacgac
aagaggaaacctatgtcattgatggctgatactaccaccgccaatgctcaggttcgtaca
ctttccgagaccgtccgtcttgatgccagaacaaagcttcttaaccccaagttctacgaa
ggtatgttgtctactggatacgaaggtgttcgtgaaatccagaagcgtcttcgtaatacc
atgggatggtctgccactgctggagaagttgacaactttgtgtttgaggatgccaacgac
gtctttatcaacgatcctgagatgcaacaacgacttcttgataccaaccccaatgcattc
cgtgatatggtgaccactttcttggaggcgaatggacgtggatactgggaaacttctgag
gagaacattgaacgtcttcaggaattgtacgctgaggtcgaggatcgtatcgaaggagtg
taa

DBGET integrated database retrieval system