KEGG   Thalassiosira pseudonana: THAPSDRAFT_268070Help
Entry
THAPSDRAFT_268070 CDS       T01078                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tps01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tps00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tps00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 498 aa AA seqDB search
MRFKSTRDASNTYSFEQALCSGYAPDGGLFVPALLPSLSAEEHLIPWSTLTFPELAFDVL
RMFISPSEISDVDLKHICAQSFTPYEFDDDDYIPIKKLNSVYLAELFHGPTFCFKDFGMR
PVIYLLSHFASLRNQPTTLLVATTGDTGPAAVHAVGSVGNPLLTIIVHYPENQISEFQRK
QLTTVDSKCVKIASFEGGGDDMDWPIKETGVIGEENKKRSYCGINSYNIGRPLVQMVHFV
ISIVLTPSLKGCIIDAVLPTGAMGNMTGGYMAKLMGVPIGKLCAGVNINDITYRVIERGE
FHKEKIQKTLSDAINIEVPYNFERILYYLTRGNNTLVKQWMQTMEQTQQVTLDGKWLERL
QTDFCSARITDDEMCSTLRRTFDEWGYVVDPHTAVALAATERLGYQLFKHQSPSSETKNH
VVVLATASPCKFQEAVTVALGEKGWEVYIKNGFPSRARDTMDKDEMKPYHYTWREGATVK
EVQSEWRLQMLEIVNDSF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagattcaaatccactcgtgatgcatccaatacctacagctttgagcaagctctttgc
tcgggttatgcacccgacggaggtctctttgttcctgcactactgccatcgctgtctgcc
gaggagcatttgataccgtggtctacgttgacatttccggagttggcgttcgatgtgttg
cgaatgttcatatcaccaagcgaaatcagtgatgtagacctcaaacacatttgtgcacaa
tcgttcacaccctatgagtttgacgacgacgactacattccaatcaagaagctcaattca
gtataccttgctgaattatttcacggaccaaccttttgcttcaaagactttgggatgcga
cctgtgatatatcttctatcacactttgccagtctacgaaatcaaccaaccactcttctc
gttgccaccactggtgatacaggaccagctgccgtgcatgctgttggtagtgtaggaaac
ccacttttgacaattattgttcactacccagagaatcagattagcgagttccaaaggaag
caactgacgacagtagattcaaagtgtgtcaagattgcatcgtttgagggaggtggggat
gatatggattggccaatcaaggaaactggagttattggggaagaaaacaagaaacgatca
tattgtggaatcaactcgtacaacattggacgtcctttggtacagatggtgcatttcgta
atcagtatcgttctgacgccgtccctaaaaggttgcatcattgatgcagtactaccgacg
ggtgcaatgggaaacatgactggggggtatatggcaaagcttatgggggttcctattgga
aagctgtgtgctggagtgaacataaatgacatcacttaccgagtcattgaaagaggcgag
tttcataaagaaaagatacaaaagacgttgtcggatgcaatcaacattgaagtgccttac
aactttgaaaggattctctactacttgacgagaggaaacaatacacttgtgaagcagtgg
atgcaaacgatggagcaaacacaacaagtcacattagatggcaagtggttagaacgactc
cagaccgacttttgcagtgctcgtattaccgatgatgaaatgtgcagcacgcttcgtcgg
acttttgatgagtggggctacgttgttgatccacacacagcagtagcattggccgcaaca
gaaaggttgggataccaacttttcaaacatcaatcaccgtcgtcggaaacgaagaatcac
gtcgtcgtacttgccactgcgtctccttgtaagttccaggaagctgtaaccgtggcgctt
ggagagaagggatgggaagtgtatatcaagaacggctttccttctcgtgcacgagatacc
atggacaaagatgaaatgaagccatatcattatacgtggagagaaggggcgacggtgaag
gaagttcaatcagagtggaggttacaaatgcttgagattgtgaacgattcattttga

DBGET integrated database retrieval system