KEGG   Thalassiosira pseudonana: THAPSDRAFT_268070Help
Entry
THAPSDRAFT_268070 CDS       T01078                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00260  Glycine, serine and threonine metabolism
tps00750  Vitamin B6 metabolism
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THAPSDRAFT_268070
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    THAPSDRAFT_268070
Enzymes [BR:tps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     THAPSDRAFT_268070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 7443137
NCBI-ProteinID: XP_002286875
JGI: 268070
UniProt: B8BRC6
Position
1
AA seq 498 aa AA seqDB search
MRFKSTRDASNTYSFEQALCSGYAPDGGLFVPALLPSLSAEEHLIPWSTLTFPELAFDVL
RMFISPSEISDVDLKHICAQSFTPYEFDDDDYIPIKKLNSVYLAELFHGPTFCFKDFGMR
PVIYLLSHFASLRNQPTTLLVATTGDTGPAAVHAVGSVGNPLLTIIVHYPENQISEFQRK
QLTTVDSKCVKIASFEGGGDDMDWPIKETGVIGEENKKRSYCGINSYNIGRPLVQMVHFV
ISIVLTPSLKGCIIDAVLPTGAMGNMTGGYMAKLMGVPIGKLCAGVNINDITYRVIERGE
FHKEKIQKTLSDAINIEVPYNFERILYYLTRGNNTLVKQWMQTMEQTQQVTLDGKWLERL
QTDFCSARITDDEMCSTLRRTFDEWGYVVDPHTAVALAATERLGYQLFKHQSPSSETKNH
VVVLATASPCKFQEAVTVALGEKGWEVYIKNGFPSRARDTMDKDEMKPYHYTWREGATVK
EVQSEWRLQMLEIVNDSF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagattcaaatccactcgtgatgcatccaatacctacagctttgagcaagctctttgc
tcgggttatgcacccgacggaggtctctttgttcctgcactactgccatcgctgtctgcc
gaggagcatttgataccgtggtctacgttgacatttccggagttggcgttcgatgtgttg
cgaatgttcatatcaccaagcgaaatcagtgatgtagacctcaaacacatttgtgcacaa
tcgttcacaccctatgagtttgacgacgacgactacattccaatcaagaagctcaattca
gtataccttgctgaattatttcacggaccaaccttttgcttcaaagactttgggatgcga
cctgtgatatatcttctatcacactttgccagtctacgaaatcaaccaaccactcttctc
gttgccaccactggtgatacaggaccagctgccgtgcatgctgttggtagtgtaggaaac
ccacttttgacaattattgttcactacccagagaatcagattagcgagttccaaaggaag
caactgacgacagtagattcaaagtgtgtcaagattgcatcgtttgagggaggtggggat
gatatggattggccaatcaaggaaactggagttattggggaagaaaacaagaaacgatca
tattgtggaatcaactcgtacaacattggacgtcctttggtacagatggtgcatttcgta
atcagtatcgttctgacgccgtccctaaaaggttgcatcattgatgcagtactaccgacg
ggtgcaatgggaaacatgactggggggtatatggcaaagcttatgggggttcctattgga
aagctgtgtgctggagtgaacataaatgacatcacttaccgagtcattgaaagaggcgag
tttcataaagaaaagatacaaaagacgttgtcggatgcaatcaacattgaagtgccttac
aactttgaaaggattctctactacttgacgagaggaaacaatacacttgtgaagcagtgg
atgcaaacgatggagcaaacacaacaagtcacattagatggcaagtggttagaacgactc
cagaccgacttttgcagtgctcgtattaccgatgatgaaatgtgcagcacgcttcgtcgg
acttttgatgagtggggctacgttgttgatccacacacagcagtagcattggccgcaaca
gaaaggttgggataccaacttttcaaacatcaatcaccgtcgtcggaaacgaagaatcac
gtcgtcgtacttgccactgcgtctccttgtaagttccaggaagctgtaaccgtggcgctt
ggagagaagggatgggaagtgtatatcaagaacggctttccttctcgtgcacgagatacc
atggacaaagatgaaatgaagccatatcattatacgtggagagaaggggcgacggtgaag
gaagttcaatcagagtggaggttacaaatgcttgagattgtgaacgattcattttga

DBGET integrated database retrieval system