KEGG   Thalassiosira pseudonana: THAPSDRAFT_269076Help
Entry
THAPSDRAFT_269076 CDS       T01078                                 

Definition
ubiquitin specific protease (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     THAPSDRAFT_269076
Peptidases [BR:tps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THAPSDRAFT_269076
Exosome [BR:tps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   THAPSDRAFT_269076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 773 aa AA seqDB search
MDTSTGTSATKLGVGVEGGFQSDLDKYDTISTHSIVLMNKSSGIVVELPYNEDTKNDFPM
LVSQSADSVINHAGLAVQQDLKAWELDEEPKPVSKYAEGLPFVDNGVKVSSNPADWKCEQ
TGEVTDHLWLNLSDGFIGGGRKNWDGSGGTNGALDHFAATGEKYPLVVKMGTITDDISTA
DCYSYAKDEDGPVTIPNLKELLEKRGIIVAGMQKTVKSTAELEVELNATYAFDAITEKGA
HLVPVAGPGLQGLQNLGNSCYMNSVVQMLLGGSIPELASRYGSVGSDVTKNPLIGISASS
ASNDLLCQAAKLSTALTSGVFCRPLPESVEVSDPSSSDPKYRLAPRMFKNVVGHDHVDFG
TGQQQDAAQYFQYLLESKDDSDAALVTSHLFSYKTESRLVCEADSLIKYKESPAETMLSL
RIPMSEATTAVGDAPDVKRQKSEDSGEDGKEKKEVPTVTIDACLNAWSASTTIDDCRWPH
LQNAVSRATSTTRFANFPRYLLVHMQRYELGDDWQPHKIEVDIDVPEEISLHTLRSTGPQ
DGENLVPPESEVGEAPAVPSASTLDENALSQLIEMGFNMNGCKRALMAVGGSNVEAAMNW
VFEHNGDADFNDPLPEGSESAGVAAASDSGVDEGVVMSLVENLGCFNADQVRAALKHCNG
AADRAADWLFSHMDDLDSAIASLDNVAPAGNTVSSKSSVPLEDGDGKYNLVGLVSHIGKN
TGSGHYVAHLKKDGKWVIFNDEKVALSEHPPTRHAYMYLFQRSDTVGSPHAGY
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggatacaagtacggggacatcggctacaaagctaggagtgggtgtggagggaggattt
caatccgatctagacaagtacgacactatttcaacccattccattgtcctcatgaacaaa
tcatccggtatcgttgtcgaactgccctacaatgaagacaccaaaaatgatttccccatg
ctagtatcacagagcgccgattcggtcattaaccatgctggtttggcagtacagcaggat
ttgaaggcgtgggagttggatgaggaacccaagcctgttagcaagtacgccgagggattg
ccatttgtggataatggggtgaaggttagctctaatccagctgattggaagtgcgagcaa
actggagaagtgacagatcacctatggctcaacctaagtgatggtttcatcggtggagga
cgtaagaactgggacggaagtggaggtaccaacggagcattggaccatttcgcggccact
ggtgagaagtatcccctcgttgtgaagatggggacaatcacggacgatatcagcactgca
gattgttattcgtatgcgaaggatgaggatggtcctgttacgattcctaatttgaaggag
ctattggagaagcgtggcattattgttgctggaatgcaaaagactgtcaaatccactgct
gaattggaagttgaactcaacgcaacgtatgcttttgacgccatcactgagaaaggagca
catcttgtgccagtggctggaccaggtcttcaggggctacaaaaccttggcaactcttgt
tacatgaactctgttgtccaaatgcttctcggcggatcaatacctgaactagcttctaga
tatggctctgttggatctgacgtgacgaagaatccactaattgggatatcggcatcttcg
gcatcaaacgatttgctttgccaggcagccaaactctccactgctttgacgagtggtgtg
ttttgtcgtccgcttcctgaatccgttgaagtatcagacccttcttcctcggatcccaaa
tatcggttagctcctcgtatgttcaagaacgtcgtgggacatgatcatgtcgactttggg
actggccaacagcaggatgctgctcagtactttcagtacctgttggagagcaaagatgac
agtgatgctgctctcgttacgtcgcatttgttctcatacaagacagagtcacgtttggtt
tgcgaggctgatagtttgatcaagtacaaagaaagtcccgcagaaacgatgctgagtctc
cgtatccccatgtctgaagcgacaaccgccgttggtgatgctcctgatgtgaagcgacaa
aagtctgaagattctggagaagatggcaaagaaaagaaggaagtgccaactgttactatt
gacgcatgtctgaatgcatggtctgcttctaccaccatcgatgactgtcgctggcctcat
ttgcagaatgccgtgagccgtgctacgtcgacaactcgcttcgcaaattttccacgttat
ctcttggtgcatatgcagcgttacgaactcggcgatgattggcaacctcacaaaattgaa
gtcgacattgatgttccagaagagatttcacttcatacgctcaggagcactgggcctcaa
gacggagagaacctcgtccctcctgagtccgaagttggagaagctcccgctgtaccctcg
gcttctacacttgatgagaatgcattgtcacagctcattgaaatggggttcaatatgaac
gggtgtaagagagctttgatggccgttggcggatccaacgttgaagcagcaatgaattgg
gtgtttgagcacaatggagatgctgacttcaacgatcctttgcctgaaggaagtgaaagt
gctggtgtggctgcagcaagtgattctggcgttgacgaaggtgtcgtcatgtcgctcgtt
gagaatcttgggtgtttcaatgcagatcaagtacgagcagcattgaagcactgcaatggt
gctgctgatcgtgcagcagactggttgttctctcacatggatgatctcgacagtgccatt
gcatctttggacaacgttgctccggcagggaacactgtatcgtcgaagtcttcagttcct
ctagaggatggagatggcaagtacaacttggttggtttggtcagtcatattggaaagaat
actggaagcggtcactatgttgctcacttgaagaaagacggcaaatgggttatcttcaac
gatgagaaggttgccttgtccgagcaccctcctactcgccatgcctacatgtacttgttt
cagcgaagtgatactgttggatcgcctcatgctggctattag

DBGET integrated database retrieval system