KEGG   Thalassiosira pseudonana: THAPSDRAFT_26931Help
Entry
THAPSDRAFT_26931  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tps  Thalassiosira pseudonana
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THAPSDRAFT_26931
Enzymes [BR:tps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     THAPSDRAFT_26931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 185 aa AA seqDB search
MTTACRTILECIGEDPNREGLLKTPERWAKALLFMTRGYSLSPEKVLNNAIFTEDSHKEI
VVVKNIDIHSMCEHHMVPFTGQIHVGYIPNGKIIGLSKIARIAEVYSRRLQVQERLTRQI
VDAIVEHVEPLGVGVVVECSHFCMVMRGVQKVGAKTVTSCVRGCFESNMKTRAEFFNIIN
GGMSR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgcatgccgcacaatcctcgaatgcatcggcgaagatccaaaccgcgaagga
ctcctcaaaacaccggaacgatgggccaaggcccttctcttcatgactcgggggtactcc
ctctctcccgagaaggtactaaacaatgcaatctttaccgaagacagtcataaagagatt
gtggtcgtcaagaacattgacattcattccatgtgcgaacatcacatggtcccattcacc
ggtcaaatccacgtagggtacattcccaacggcaagattatcggattgtccaaaatagcg
cggattgccgaggtgtactcccgtcgtcttcaggtgcaagaacgtctcactcgacagatt
gtcgatgcgatagtagaacatgtagagccattgggcgtgggtgtggttgtggagtgtagc
catttctgtatggtaatgaggggtgtgcagaaggtgggggcgaagactgtgactagttgc
gttagggggtgttttgagagtaatatgaagacgagggcggagttctttaacattatcaat
ggggggatgagtagatga

DBGET integrated database retrieval system