KEGG   Thalassiosira pseudonana: THAPSDRAFT_26931Help
Entry
THAPSDRAFT_26931  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tps  Thalassiosira pseudonana
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tps00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 185 aa AA seqDB search
MTTACRTILECIGEDPNREGLLKTPERWAKALLFMTRGYSLSPEKVLNNAIFTEDSHKEI
VVVKNIDIHSMCEHHMVPFTGQIHVGYIPNGKIIGLSKIARIAEVYSRRLQVQERLTRQI
VDAIVEHVEPLGVGVVVECSHFCMVMRGVQKVGAKTVTSCVRGCFESNMKTRAEFFNIIN
GGMSR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgcatgccgcacaatcctcgaatgcatcggcgaagatccaaaccgcgaagga
ctcctcaaaacaccggaacgatgggccaaggcccttctcttcatgactcgggggtactcc
ctctctcccgagaaggtactaaacaatgcaatctttaccgaagacagtcataaagagatt
gtggtcgtcaagaacattgacattcattccatgtgcgaacatcacatggtcccattcacc
ggtcaaatccacgtagggtacattcccaacggcaagattatcggattgtccaaaatagcg
cggattgccgaggtgtactcccgtcgtcttcaggtgcaagaacgtctcactcgacagatt
gtcgatgcgatagtagaacatgtagagccattgggcgtgggtgtggttgtggagtgtagc
catttctgtatggtaatgaggggtgtgcagaaggtgggggcgaagactgtgactagttgc
gttagggggtgttttgagagtaatatgaagacgagggcggagttctttaacattatcaat
ggggggatgagtagatga

DBGET integrated database retrieval system