KEGG   Thalassiosira pseudonana: THAPSDRAFT_269475Help
Entry
THAPSDRAFT_269475 CDS       T01078                                 

Definition
sir2-type regulatory transcription factor silent information regulator protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     THAPSDRAFT_269475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 280 aa AA seqDB search
MSASYAERLSEYPNKGVCGLPESYDTPRSFTSKLDALTKLVKRSRHTVVLTGAGISTGAG
IPDFRGPSGIWTKEQERKKREKRALSKKKIFTSFASAIPTYTHRTLTSSNNNKFLHHIVT
QNIDGLHRKTHLPRQHQSILHGCIFTEICDTCHTEHVRSYEIDSIGLKYTGNVCTLGGSS
GSGSCKGKLKDTLLDWEDALPDVDWTRAQEECEKADLIVCLGTSLRIEPAGSLCGGSGGG
GGRSSKLGYAIVNLQQTPYDDGAALVIRAKVDDVMRGLMA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaagctatgcagaacgattgtcagaatatcccaacaagggggtatgtggcctc
cccgaaagctacgacacgccacgatcgttcacatccaaattagacgctcttaccaagctt
gtcaaacggtcgaggcatacagtggtgcttactggtgcgggcatttctactggagcggga
attccagactttagaggccccagcggcatttggaccaaagaacaagaacgcaaaaagagg
gaaaagagggcattatcaaagaagaagatattcacatcctttgcatcggcaatcccaacc
tacacccatcgaacactcacttcctcaaacaacaacaaattcctacaccacattgtaaca
caaaacattgacggactccaccgcaaaacacacttaccacgacagcatcaatccatcctt
catggatgcatctttactgaaatttgcgacacttgtcatacggagcatgtacgttcgtat
gaaattgactcgattggtctaaagtatactgggaatgtgtgtacactgggtggtagtagt
ggcagtggatcatgcaaggggaagttgaaggatacgttgttagattgggaagatgctttg
ccggatgtagattggacgcgtgcacaggaggagtgtgaaaaggcagatttgatagtgtgt
cttgggacgagtttacgtattgaacctgccggttcattgtgtggtggtagtggtggcggt
ggtggtaggagcagcaagttggggtatgccattgtgaatctgcagcagactccgtatgat
gatggggcagcgttagtgattcgagctaaagtggatgatgtgatgagggggttgatggct

DBGET integrated database retrieval system