KEGG   Thalassiosira pseudonana: THAPSDRAFT_269540Help
Entry
THAPSDRAFT_269540 CDS       T01078                                 

Gene name
CHC
Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
tps  Thalassiosira pseudonana
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tps00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    THAPSDRAFT_269540 (CHC)
Exosome [BR:tps04147]
 Exosomal proteins
  Proteins found in most exosomes
   THAPSDRAFT_269540 (CHC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 1718 aa AA seqDB search
MAGVPIAFSEVLNLQQLGIPETSIKHGLTTMESDKWIVSVEPTQVSLIDLQNQAAVTRRP
IKAEAAVMNPSSNILALRSGKMIQMFNLDTKQKLKSHDMDSPIVFWKWTSADNLALVTAT
SVHHWSSTEGSSAPTKMFDRHPTIGPNTQIINYQVSPDSKWCLLGGISANPGGGVNGNMQ
LYSVEKKVSQPLQGHAGAFHKFKVSGREDEAQVLVFHEKKSDDPAHKLFVMEVGRDPSKG
QPFRIPPTVIPVPPEAAADFPVSLVVDAKDDVAFLLSKMGFVYMFDIQSGKTMFRTRITQ
ETVFVTCSQSSTGAVFGITVRTGKVLRISLNGQNLVPYIVNTLRDNDLAIKVAGRLGLPG
AEHLYTAEFERLISAGQVKEAAVLVANSGSALRTPQTIARFQQIPAQPGAPQPVFQYFST
LLENVKLNEQESIELAKPVLQQGRPQLMEKWLKDDKLHCSEALGDLIMPHDTAMALSVYL
RSECHAKAIQCFVQRGEYDKIVPYSTSVGYSMDYSSMLSQLLFNNPQGALDLAKGLVSAE
GGPLIDIQATAEAFLSSNRVQETTAFLLEALKDNKQEHAYLQTKLLEINLIGGAPQVADA
IMQNGILTHYDKAHVGKLCERAGMWQRAAEHYTDINDIKRVFKNSHQMNPEFVVTYFGKL
NRDQSIALLKDMLSRGPTNMQVCVEVAKKYHEELGASELVKVFEANKATEGLYYFLGAVV
NFSEDSVVHFKYIQSACMLGQFKEAERVCRDSNIYDPAEVKEYLKNAKLPDPRPLIHVCD
RFDFVDELTEYLYLNSLLQYVEVYVTKVSPTKTPQVVGKLFDLGANQDFVKRILMAVGTA
CPVDEMVEIAETRNRLRMLQPWLEARVATGSTEPGTHNALGKIYIQMNKDPKAFLTNNMF
YEPKVLGPFCESLDPSLAFVAYKKGAGECDDELIKISFTHGLYRDLARYLVERQDLELWA
KSATEKESQRRQLIDQVVEWALPESTSADEVSCTVKAFMAADLPGELITLLERIILQGSD
FSDNKNLQNLLILTAIRADHTRVASYIDQLDNFDAKDIALICVSESHMLYEEAYSIYNKF
AKPEFTQEKEEQVEMQVLAIGVLVDFMKDLDRAKGFANQVDEKPVWSKLGKSQLEEKMAA
EAILSFINAEDASEYVKVCAEANEAEIYTELIPFLKMARKGLQENLLDTELIYAYAKTNN
LTELEVFVNGPNVSNIQNIGDRCFSEGLYHAAKLLYTNINNNSKLALCHIHLEEYREAVA
AATKANNVSTWKQVCFACLKADEFRLASTCGLEVIKYPDHLDEVVTFYSDLGHFDHLISL
FEQGLGLEDAHIGIFTELGILYTKHVPDKVMEHCKVFFSKLNVSKVVRACERARLWAPAV
YLYMADKQFDNAVKVMSERANSFDNDLFLDSIVKVRNAEIMYKAVNFYLTMHPTLFTRLM
EVLEDHVDHSRVVNQLRRTGDWALQIGQAYMKSVQKANLSAVNEALNELYIEDEDYESLR
KSIDKFKNFNMIALASKLATHELLEFRRISAYVYRCNSKWSQSIELSKNDRMWKDCIDTA
NESADAEIIENLLRFFCETSEKECFCAALYTCFAHVRPDVVLELGWLNGYHNFIMPFFIQ
NMRQTHDRLRALEERTKPPKEDENQDLIAQTYSQLGGFNNMLMLENAPGGGMPGMPPQHG
GGIDMSGFANAGGMQLQPGMMPNGGMPQPGMMPNGGMY
NT seq 5157 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggttcctattgccttcagcgaggtgctcaatcttcaacaattgggcatcccc
gaaacctccatcaaacatggcctcaccaccatggaatccgacaaatggatcgtctccgtc
gaacccacccaagtctcactcattgacctccaaaaccaagcagccgtcacccgtcgtccg
atcaaggcagaagcagccgtcatgaacccatcctccaacattctcgctttgcgatctgga
aagatgattcaaatgttcaatcttgacacgaagcaaaagttaaagtctcacgatatggac
agtcccattgtcttctggaagtggacttcggcagacaaccttgccctcgtcaccgccacc
tccgtacaccactggtcgtccaccgaggggtcctccgcccccaccaaaatgtttgaccgt
catccaaccattggacccaatacccaaatcattaattatcaagtctcccccgattccaag
tggtgtttgctcggtggcatcagtgccaatcccggtggcggagtcaatggcaacatgcag
ctttacagtgtggagaagaaggtgtctcagcctcttcagggacatgccggtgcatttcac
aagttcaaggtgtcaggtagggaggatgaggctcaggttctcgtctttcacgagaagaag
tcagatgatcctgcacataagttgttcgtgatggaggtgggaagggatccttccaaggga
cagccgtttcgtattccccccactgtgattcctgtgcctccggaggcagctgcggatttc
ccagtgtctcttgtggtggatgcgaaagatgatgtcgcgttccttctttccaagatgggg
ttcgtctacatgtttgatattcagagtggaaagaccatgtttcgcacaaggataacgcag
gagactgtatttgtcacttgttctcagtcttctactggggcagtgtttggaattaccgtt
cgtacgggaaaggtgcttcgtattagcttgaatgggcagaatttggttccttacattgtc
aatacgttgagggacaatgatttggccattaaggtggctggacgattgggtcttcctgga
gctgagcacttgtacactgccgagtttgaacgtctcatctctgccgggcaagtgaaggaa
gcggctgttcttgtggccaatagtggctcggcattgaggactcctcagacgattgcgcga
ttccagcaaattcctgcacagcctggtgctcctcagcccgtgtttcagtacttctctacc
ttgttggagaatgtcaagttgaatgagcaggagagtattgagttggccaagccggtgttg
cagcagggaaggcctcagctgatggagaagtggttgaaggatgataagcttcattgctcc
gaggcgttgggtgatttgatcatgcctcacgatactgcaatggctttgagtgtgtatttg
aggagcgagtgtcatgccaaggctatccagtgcttcgtgcaacgtggggagtacgacaag
attgttccctactcgacgtctgtgggatactcgatggactattcttccatgctcagtcag
ctcttgttcaacaaccctcagggtgctttggatttggctaagggtttggtcagtgccgag
ggaggaccattgattgatattcaggctaccgccgaggcctttctctccagcaacagggtg
caagagactactgccttcttgctggaagcactcaaggacaacaaacaggagcatgcctac
ctccagacgaagcttcttgagatcaacctcattggtggagctccccaagttgctgacgcc
atcatgcagaatggaattttgactcactacgataaggctcacgttggaaagctttgcgag
cgtgctggaatgtggcaacgtgctgctgaacactacaccgacatcaacgatatcaaacgt
gtcttcaagaacagccaccagatgaatcctgagtttgttgtcacctactttggaaagttg
aaccgtgatcagagcattgctcttttgaaggacatgctctcccgtggtcccaccaacatg
caagtctgtgtggaggttgccaaaaagtaccacgaggagcttggagcgtcggagcttgtc
aaggtgtttgaggccaacaaggcaacggagggtctttactacttccttggcgccgtggtg
aacttctcagaggattcggtagttcatttcaagtacatccaatctgcgtgtatgcttggt
cagttcaaggaggctgaacgtgtgtgcagggattctaacatttacgatcctgctgaagtg
aaggagtatcttaagaatgcgaagcttcccgacccacgtcctcttattcacgtgtgcgac
cgtttcgatttcgtggacgagcttacggagtatttgtacttgaacagtcttcttcagtac
gttgaggtctacgtcaccaaagtctctcctaccaaaactccccaggtcgttggaaagctc
tttgacctcggagccaatcaggatttcgtcaaacgtattctgatggctgttggaactgcc
tgccccgtggatgagatggtggagatcgccgagactcgtaatcgtcttcgtatgctccag
ccttggcttgaggctcgtgttgccactggaagcaccgaacctggaactcacaatgctctc
ggaaagatttacattcagatgaacaaggatcccaaggcgtttttgaccaacaatatgttc
tacgagcctaaagttcttggtcctttctgtgagagtttggatccttcgttggcattcgtt
gcttacaaaaagggtgctggagagtgtgacgatgagttgatcaaaatcagtttcacccat
gggttgtatcgtgatcttgcgaggtatctcgttgagcgtcaggatttggagttgtgggcg
aagtctgctacggagaaggagagtcagcgtaggcaactcattgatcaggtggttgagtgg
gcgctccctgagagtacttctgctgatgaggtgtcttgtactgtgaaggcattcatggct
gccgatcttcccggagagctcatcactcttcttgagcgcattatcttgcaaggatcggac
ttctcagacaacaaaaatcttcagaacttgctcatcctcaccgccatccgtgccgatcat
acccgtgttgcatcctacatcgatcagttggataactttgacgccaaagatattgcactc
atttgcgtgtctgagagtcacatgctctacgaggaggcatacagcatctacaacaagttt
gccaagcctgaattcacccaggagaaggaggaacaggtggagatgcaagtccttgccatt
ggcgtcctcgttgacttcatgaaggatctggatcgtgctaagggctttgctaaccaagtt
gacgagaagcctgtgtggtctaagcttggtaaatctcagttggaggagaagatggctgcc
gaggctattctcagtttcatcaatgctgaggatgccagtgaatacgttaaagtgtgtgcc
gaagccaacgaggctgaaatctacacggagcttatccccttcctcaagatggcacgtaag
ggattgcaggagaatcttttggatacggagctcatctacgcatatgctaagaccaacaac
ttgactgagcttgaggtgtttgtgaacggacccaatgtttcaaacattcagaacatcggc
gatcggtgcttctctgaggggctctaccacgcggcgaagctactctacacgaacatcaac
aacaactcgaagcttgcactttgtcacattcatttggaggagtaccgtgaggctgttgct
gcagctaccaaggcgaacaatgtttctacttggaagcaggtgtgctttgcctgtctcaag
gctgacgagttccgccttgcctccacttgtggacttgaggtcatcaaataccctgatcat
ttggacgaggtggttaccttctactctgatcttggtcactttgatcatctcatttcgctc
tttgagcaaggacttggtttggaagacgctcacattggtatcttcactgaacttggaatt
ctttacactaagcacgttcccgataaggtcatggaacattgcaaggtgttcttcagcaag
ctcaacgtgtccaaagtcgtccgtgcctgcgagcgcgctcgtctctgggctcccgctgtc
tacctctacatggctgacaagcagtttgacaatgctgtcaaggtcatgtctgaacgtgcg
aactccttcgacaacgacttgttcttggattccattgtgaaggttcgcaatgccgagatc
atgtacaaggcagtgaacttctacctcaccatgcacccaacgctttttacgaggttgatg
gaggtgcttgaagaccatgttgatcactccagggtcgtcaatcagcttcgtcgtactggt
gactgggcattgcagatcggccaggcctacatgaagtctgtacagaaggcgaatctcagt
gctgtcaatgaagctctcaacgagctctacattgaagatgaggactacgagtcattgagg
aagtccatcgacaagttcaagaacttcaacatgattgctcttgcttccaaacttgccacc
cacgagcttttggagttccgtcgtatctccgcctatgtctaccgatgcaacagcaagtgg
tctcaatccatcgagctttccaagaacgaccgcatgtggaaagactgcatcgacaccgcc
aacgaatctgccgatgctgaaatcattgagaatttgcttcgcttcttctgcgagacatcg
gagaaggagtgcttctgtgctgcactttacacttgcttcgctcacgttcgtcctgacgtg
gttcttgagcttggatggctcaacggttaccacaacttcatcatgcctttctttatccag
aacatgcgtcagactcacgatcgtcttcgtgctttggaggagcgcaccaagcctccaaag
gaagacgagaaccaagacctaatcgcacaaacttacagtcaacttgggggcttcaacaat
atgctaatgcttgagaatgctcctggaggtggaatgccgggaatgccaccacagcatggg
ggaggcatcgacatgagtggctttgcgaatgctgggggaatgcaactgcaaccaggtatg
atgccgaacgggggaatgcctcaacctgggatgatgcctaacggcggcatgtattag

DBGET integrated database retrieval system