KEGG   Thalassiosira pseudonana: THAPSDRAFT_269704Help
Entry
THAPSDRAFT_269704 CDS       T01078                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00260  Glycine, serine and threonine metabolism
tps00750  Vitamin B6 metabolism
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THAPSDRAFT_269704
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    THAPSDRAFT_269704
Enzymes [BR:tps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     THAPSDRAFT_269704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 7450508
NCBI-ProteinID: XP_002293628
JGI: 269704
UniProt: B8CBR8
Position
13
AA seq 509 aa AA seqDB search
MTSPSITYSSTRGSQSNLSFRTAVMTGLAHDRGLFVPDTFPTVSTSELESWRGLSYADLA
TEVIAKYVGEDEVPRKVLGDIVRRSCGSFRSGDVTPLVKVDGHYVLELFHGPTFAFKDVA
LQMLGNFFEYFLSTGSNGGRLAVLGATSGDTGSAAIYGLRGKKGVDCIILFPDGRVSEIQ
ERQMTTVKDGNIHCVSVEGTFDDCQDIVKASFDNMEFRNKVKLGAVNSINWCRVLAQTTY
YFWSYLRVTDAEKDVTKVNFSVPTGNFGDILAGYYAKRMGLPVGDLIVATNENDILHRFF
THGEYHREDIHKTISPSMDICVSSNFERYLYHLAGDDSTTLASWMSAFESTGKLTITGKK
LDQARADFKSARADTANTLETIKRYHSEFDYVLCPHSAVGVSAIHQLDTANSATVALATA
HFAKFGDAVSMAINPLPDIPKELSRLWNMETRKSNCPNDATVVQAFMEKRIEERVANEEA
GEKRKMQVRKLVLVSALVGLVAIVMRRRK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccccttccatcacctactcctccacccgcggctcccaatccaacctctccttc
cgcaccgccgtcatgaccggcctcgcccacgaccgcggccttttcgttcccgacaccttt
cccaccgtgtcaacgtccgaattggaatcgtggcgggggttgagttatgccgatttggca
acggaggtgattgccaagtatgtgggggaggatgaggttccgaggaaggttttgggggat
attgtgaggaggagttgtgggtcttttaggagcggggatgttacgccgttggtgaaggtg
gatggccattatgtgctggagctattccatggaccaaccttcgccttcaaagacgtagcc
cttcaaatgctcggaaacttcttcgaatacttcctttccaccggctccaacggcggtcgc
ttagccgtcctcggtgccacctccggtgacactggatccgctgccatttacggtcttcgc
ggaaagaagggagtggattgcatcattctctttcctgatgggagggtgagtgagattcag
gaacggcagatgactacagtgaaggatgggaatattcattgtgtgagcgtggagggaaca
tttgatgattgtcaggatattgtcaaggctagttttgacaatatggagtttaggaacaag
gtcaagttgggtgcagtgaactcgatcaactggtgtagggttttggctcagacaacgtat
tacttttggagttatttgagggtgactgatgcagagaaggatgttaccaaggtcaacttc
tcagttcctacgggcaactttggtgacattttggctgggtattatgccaagcgtatggga
ctccctgttggagatttgattgtggctacgaatgagaatgatattcttcatcgtttcttc
acgcatggagagtatcatcgtgaggatattcacaagacgattagtccatcgatggatatc
tgtgttagttccaactttgagcgatacctctatcatttggcgggagatgatagcactacc
ttggcgagttggatgagtgcctttgaatctacgggaaagttgactattaccggaaagaaa
ctcgatcaggcacgtgcggatttcaagagtgctagggcagatacggcaaacactttggag
acgatcaagaggtatcattccgagtttgattacgtgctctgtcctcatagtgctgtggga
gtcagtgccattcatcaactcgatactgccaactctgctaccgtggctctcgccactgct
cactttgccaagtttggggatgcagtatccatggcaatcaaccctcttcctgatatccct
aaggagctatcacgactttggaacatggagacacggaagagcaattgtcccaatgatgct
acggtcgttcaagctttcatggagaagaggatcgaggagcgagttgcgaatgaagaggct
ggagagaaaaggaagatgcaagtgagaaagttggtattggtttcagctttggttggattg
gttgctattgtgatgaggagaagaaaataa

DBGET integrated database retrieval system