KEGG   Thalassiosira pseudonana: THAPSDRAFT_269704Help
Entry
THAPSDRAFT_269704 CDS       T01078                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THAPSDRAFT_269704
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THAPSDRAFT_269704
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    THAPSDRAFT_269704
Enzymes [BR:tps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     THAPSDRAFT_269704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 509 aa AA seqDB search
MTSPSITYSSTRGSQSNLSFRTAVMTGLAHDRGLFVPDTFPTVSTSELESWRGLSYADLA
TEVIAKYVGEDEVPRKVLGDIVRRSCGSFRSGDVTPLVKVDGHYVLELFHGPTFAFKDVA
LQMLGNFFEYFLSTGSNGGRLAVLGATSGDTGSAAIYGLRGKKGVDCIILFPDGRVSEIQ
ERQMTTVKDGNIHCVSVEGTFDDCQDIVKASFDNMEFRNKVKLGAVNSINWCRVLAQTTY
YFWSYLRVTDAEKDVTKVNFSVPTGNFGDILAGYYAKRMGLPVGDLIVATNENDILHRFF
THGEYHREDIHKTISPSMDICVSSNFERYLYHLAGDDSTTLASWMSAFESTGKLTITGKK
LDQARADFKSARADTANTLETIKRYHSEFDYVLCPHSAVGVSAIHQLDTANSATVALATA
HFAKFGDAVSMAINPLPDIPKELSRLWNMETRKSNCPNDATVVQAFMEKRIEERVANEEA
GEKRKMQVRKLVLVSALVGLVAIVMRRRK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccccttccatcacctactcctccacccgcggctcccaatccaacctctccttc
cgcaccgccgtcatgaccggcctcgcccacgaccgcggccttttcgttcccgacaccttt
cccaccgtgtcaacgtccgaattggaatcgtggcgggggttgagttatgccgatttggca
acggaggtgattgccaagtatgtgggggaggatgaggttccgaggaaggttttgggggat
attgtgaggaggagttgtgggtcttttaggagcggggatgttacgccgttggtgaaggtg
gatggccattatgtgctggagctattccatggaccaaccttcgccttcaaagacgtagcc
cttcaaatgctcggaaacttcttcgaatacttcctttccaccggctccaacggcggtcgc
ttagccgtcctcggtgccacctccggtgacactggatccgctgccatttacggtcttcgc
ggaaagaagggagtggattgcatcattctctttcctgatgggagggtgagtgagattcag
gaacggcagatgactacagtgaaggatgggaatattcattgtgtgagcgtggagggaaca
tttgatgattgtcaggatattgtcaaggctagttttgacaatatggagtttaggaacaag
gtcaagttgggtgcagtgaactcgatcaactggtgtagggttttggctcagacaacgtat
tacttttggagttatttgagggtgactgatgcagagaaggatgttaccaaggtcaacttc
tcagttcctacgggcaactttggtgacattttggctgggtattatgccaagcgtatggga
ctccctgttggagatttgattgtggctacgaatgagaatgatattcttcatcgtttcttc
acgcatggagagtatcatcgtgaggatattcacaagacgattagtccatcgatggatatc
tgtgttagttccaactttgagcgatacctctatcatttggcgggagatgatagcactacc
ttggcgagttggatgagtgcctttgaatctacgggaaagttgactattaccggaaagaaa
ctcgatcaggcacgtgcggatttcaagagtgctagggcagatacggcaaacactttggag
acgatcaagaggtatcattccgagtttgattacgtgctctgtcctcatagtgctgtggga
gtcagtgccattcatcaactcgatactgccaactctgctaccgtggctctcgccactgct
cactttgccaagtttggggatgcagtatccatggcaatcaaccctcttcctgatatccct
aaggagctatcacgactttggaacatggagacacggaagagcaattgtcccaatgatgct
acggtcgttcaagctttcatggagaagaggatcgaggagcgagttgcgaatgaagaggct
ggagagaaaaggaagatgcaagtgagaaagttggtattggtttcagctttggttggattg
gttgctattgtgatgaggagaagaaaataa

DBGET integrated database retrieval system