KEGG   Thalassiosira pseudonana: THAPSDRAFT_269773Help
Entry
THAPSDRAFT_269773 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
tps  Thalassiosira pseudonana
Pathway
Metabolic pathways
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     THAPSDRAFT_269773
Glycosyltransferases [BR:tps01003]
 Glycan extension
  Type 3 chain
   THAPSDRAFT_269773
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14
AA seq 336 aa AA seqDB search
MPSITLDMKRLEVILSMNATDITYVDASGNHTTHPHMGGKDEHGRWGYVHDETALKRTQP
TFEIRDDDDRANLCKSGGTILKRVRLLCLVYTIEQNHNRIPAIRETWGQKCDGFMVVSNK
TDMILGTVNIPHEGLESYDNIYQKVRSIWAYIYDNYYDVYDYFHIGGDDLYLIVENLRHY
LESEEIQLASNGGQFLPNGYENKLYLGGGSGYTLNKAALKSLVVHGFPSCFPHEKTSAED
MMVSKCFEKIGIFPYDSKDETGAERYLQLAPGDQCTLAPGEYGKDNKLWWYHKFNEHDKE
VKFGTDHCSANAVNFHYVNSDLMRRIHALLYRYCER
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccatcgataactctggacatgaaacggctggaagtgatattgagtatgaatgcaact
gatatcacgtacgtcgacgcctctggtaatcacaccactcatcctcatatgggagggaaa
gacgagcatgggagatggggatatgtacacgacgagacggcattaaagcgaactcagcct
acgtttgagattagagacgacgacgacagagccaacttatgcaaaagtggaggtacgata
ctgaagagagtaaggctattatgtttggtttataccattgaacaaaaccacaatagaata
ccagccatcagagagacatggggccagaaatgtgatggttttatggtggttagcaacaaa
acagacatgatactaggaaccgtgaacataccccacgagggacttgagagctacgacaac
atatatcagaaagtacgctcaatttgggcctacatttacgacaactactacgacgtgtac
gactactttcacattggtggtgacgatctttatctcattgtggaaaacctgaggcactac
ctcgaaagcgaagagatacaactagcatctaacggtgggcaatttttgcccaatgggtac
gagaacaagctctatttggggggaggcagtggctacacactaaacaaagcagcgttgaag
tctctggttgtgcatggatttcctagttgtttccctcacgagaagacatctgcagaagac
atgatggtatcgaaatgcttcgagaagatcggtatctttccgtacgacagcaaagacgag
actggcgcagaacgatatctacaacttgcccctggtgatcagtgtactcttgctcctggg
gaatatggtaaagacaacaagctttggtggtatcacaagtttaacgagcatgacaaggag
gtcaagttcggtactgatcactgctcagcgaacgctgttaacttccattacgtcaacagt
gatcttatgcgacggattcatgctttgttatatcgctactgtgaaaggtag

DBGET integrated database retrieval system