KEGG   Thalassiosira pseudonana: THAPSDRAFT_270246Help
Entry
THAPSDRAFT_270246 CDS       T01078                                 

Gene name
ACS2_2
Definition
acetyl-coenzyme a synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THAPSDRAFT_270246 (ACS2_2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_270246 (ACS2_2)
   00620 Pyruvate metabolism
    THAPSDRAFT_270246 (ACS2_2)
   00640 Propanoate metabolism
    THAPSDRAFT_270246 (ACS2_2)
Enzymes [BR:tps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     THAPSDRAFT_270246 (ACS2_2)
Lipid biosynthesis proteins [BR:tps01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   THAPSDRAFT_270246 (ACS2_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 731 aa AA seqDB search
MLSKAAFVLLLNLSTTGVDAFAPTSLNRLVSRSINIGTGHYKLASTKEGDGDEPDHMPEL
REIAPTFDAKISNTAFERYKSDYAYSLSHNARYWNEKATSLLTWEHYPYNSDNCDGVLTG
GFKHGDIAWFQGAKLNVCYNAIDRHAQNPAKKDQVAMIYEGDEPGHVLKYTYSDMLRHVS
EIANALKSQGVKKGDVVTIYMPMIPQLPMTILACARIGAIHSVVFAGFSSEALSARISAS
NSKFVATADNGMRGSKLIGLKKIVDDAIEKNDCSDIVEKVLMFERERSVAPPGSDVKDSS
DEPTINWNNERDVNMNDILPKQRPYCPPESMDAEDELFILYTSGSTGQPKGLVHTTGGYA
LYAAHTTQTTFDLQPNDIFACVADCGWITGHTYVVYGPLLSGGTTVLFESTPLYPDAGRY
WEMIQRHQISVFYTAPTAIRSLIRFGDEVPKKYDLSSLRILGSVGEPINPAAWSWYYEAV
GQEKCTIVDTYWQTETGAHIVTNIPGVTPMKPGSCTLPLYGIDTVVLDPMTGDIIEGNDV
EGVLAIRSPWPGIARTCLGDHERYLTTYLKPYKNYYFTGDAVYRDKDGFYFITGRVDDVL
NVSGHRIGTAEVESALVKHPSIAQAAVVGRPHPIKGEAIIAFATPTESNNEDDDELVKEL
RLMVRTEIGPFAAPDVICITPSLPMTRSGKIMRRVLRKISAGEADQLGDVSTLADPSVVD
VLIELIAEHDA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcttagcaaagctgcattcgtcctactcctcaatctctctacaactggggttgatgcg
ttcgccccaacatcattgaaccgcctcgtcagtcgatccatcaatatcggcacagggcac
tacaagcttgcctccaccaaggaaggtgacggagatgaacctgatcacatgcccgagctg
cgagagattgcaccaacctttgatgcaaagatctcaaatacggcgtttgaacgatacaaa
tctgattatgcatactcgctatcgcacaacgctcggtactggaatgagaaagcgacgtca
ctcttgacgtgggaacactatccatacaactctgacaactgtgatggagttcttactggc
ggctttaaacacggtgatatcgcctggtttcagggggcaaagctcaacgtatgctacaat
gcaatcgatcggcatgcacaaaacccagcgaagaaagaccaagttgcaatgatatacgag
ggggatgagcctggtcatgtcctgaagtacacttattcggatatgcttcgacatgtatca
gagattgcaaatgcactcaagtctcaaggagttaagaagggggatgtcgtgacgatttat
atgcccatgatacctcaacttcccatgacgattctcgcgtgtgcaaggattggagcgatc
cactcggtagtgttcgcaggattctctagtgaggccttatctgcaagaatctcagcatcc
aactccaagtttgtagctactgcagacaatggtatgaggggcagcaaattgattggattg
aagaagattgtggatgatgcaattgaaaagaacgactgtagtgatattgttgagaaggta
ttgatgtttgaacgtgagagatcggttgctccccctggatctgatgtaaaggattcttct
gatgaaccaacaataaactggaacaatgagagagacgttaatatgaatgatattttgccg
aaacaaagaccttactgtccaccggagtcgatggatgccgaagatgaactcttcatatta
tacacttcgggtagtactggccaaccaaagggactagttcatacgacgggaggatatgca
ctctatgcggcacataccacacaaacgacatttgatctccaaccgaatgatatatttgca
tgcgtcgcagactgcggatggattacgggtcatacatacgtcgtctacgggcctttgctg
agtggaggcacgactgtcttgtttgaatcaacacctttgtatcccgatgcaggaagatac
tgggagatgatccagcgccatcaaatctctgttttttacacggcacccacggctattaga
agcctgatccgttttggagacgaggttccaaagaagtatgatctttcatcgttgaggatc
cttggtagtgtcggagaacccatcaatccagctgcatggtcgtggtattacgaagcagtt
ggtcaagagaaatgtaccattgttgacacgtactggcaaacggaaactggagcacacatc
gtaacaaacattccaggagtaacaccaatgaaaccaggatcgtgcacactccctctctac
ggtattgacactgtcgtccttgatccaatgactggcgacatcattgagggaaatgacgtt
gagggagtacttgcaattcgcagtccttggccaggcattgctaggacttgtctcggtgac
cacgaacgatacctcacaacatacttgaaaccttacaagaactactatttcaccggagat
gccgtttaccgtgacaaggatggcttctactttatcacaggacgagtggacgatgttttg
aacgttagtggtcacaggattggaactgccgaagtagagtcggctctcgtaaaacatcct
tctattgctcaggctgcagttgttggacgcccccatccaatcaaaggcgaggccatcatt
gcctttgcgacgcccactgaatccaataacgaggacgacgacgaacttgtgaaagagtta
cgcttgatggttcgcactgagatcggcccctttgctgcgccagatgtcatctgtattacg
ccctcacttcctatgacgagatcaggcaagatcatgcgaagagtattgagaaagatctct
gctggagaagcagatcaacttggagatgtcagcacgctggccgatccaagtgtagttgat
gtcttgatcgagctgattgccgaacacgacgcgtag

DBGET integrated database retrieval system