KEGG   Thalassiosira pseudonana: THAPSDRAFT_270280Help
Entry
THAPSDRAFT_270280 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tps  Thalassiosira pseudonana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THAPSDRAFT_270280
Enzymes [BR:tps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     THAPSDRAFT_270280
Exosome [BR:tps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THAPSDRAFT_270280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 400 aa AA seqDB search
MKITLLAITLACSNAFAPVSVSRTTSLSMGAGNMEPVDRTMNGIDDNLGYEAFDPTAGEN
PAVARNNQGGVWVQQRARPRRNRKSAGVRAMVRENIVTPSNFIYPLFIHDEDFCQDISSM
PGCQRHSLPSMLNEVGEALELGVKAFVLFPKVDDALKTNLACEAYNPEGIVHRSIRMIKE
KYPEAIVCTDVALDPYSDQGHDGVVEDGVILNDVTVNQLCKQAVSQARAGADIVAPSDMQ
DGRVKAIRDALDSEGFTNVSILSYTAKYASAYYGPFRDALDSHPGFGDKKTYQQDPANGR
EALIEAALDAAEGADMLMVKPGMPYLDIIRRLKDNSDLPIAAYHVSGEYAMLKAAVEKGW
LDEKAVVLETLTCFKRAGADIILTYYAKQAAKWIKEDGLY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcactctcctcgccatcacactcgcatgcagcaatgcctttgctcccgtttct
gtgtcaagaacaaccagcctttccatgggagctggaaacatggagcctgttgaccgaacc
atgaatggtatcgatgacaatcttggatacgaggcgtttgatcctactgctggcgaaaat
ccagctgttgcaaggaacaatcagggtggcgtttgggttcagcagcgtgctcgtccacgt
cgcaaccgtaaatctgctggagtccgtgccatggttcgtgaaaacattgtcactccctcc
aacttcatctaccctctcttcatccacgacgaggacttttgccaagatatttcttcaatg
cctggatgtcagcgtcattctttgccttccatgcttaatgaggttggagaggctttggag
ttgggagttaaggcgttcgtgttgtttcctaaggtggatgatgctttgaagacgaacttg
gcatgtgaggcttacaatcctgagggaattgtgcatcgttctattcgcatgattaaggaa
aagtatcctgaggctatcgtttgtaccgatgtggcgttggatccttattctgatcaggga
catgatggtgttgttgaggatggagttatcttgaacgatgttaccgtgaaccagctttgc
aagcaggctgtttcgcaggctagggccggagctgatatcgttgctcccagtgatatgcaa
gacggacgtgtcaaagctattcgtgatgctcttgactctgagggcttcaccaatgtttcc
atcctctcctacactgccaaatacgcttctgcatactatggacccttccgtgatgctctt
gactctcaccctggattcggagacaaaaagacttaccaacaggatcctgcgaatggacgt
gaggcactcatcgaagctgctcttgatgccgctgagggagctgatatgctcatggttaag
cctggaatgccttatttggacatcattcgtaggttgaaagacaactctgatttgcctatt
gctgcctaccatgtcagtggagagtatgccatgttgaaggctgctgttgagaagggatgg
ttggacgagaaggctgttgttttggagactttgacttgcttcaagagggctggagcagat
atcattcttacatactacgcaaaacaagctgccaagtggatcaaggaggatggactttat
taa

DBGET integrated database retrieval system