KEGG   Thalassiosira pseudonana: THAPSDRAFT_270280Help
Entry
THAPSDRAFT_270280 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tps  Thalassiosira pseudonana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tps00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 400 aa AA seqDB search
MKITLLAITLACSNAFAPVSVSRTTSLSMGAGNMEPVDRTMNGIDDNLGYEAFDPTAGEN
PAVARNNQGGVWVQQRARPRRNRKSAGVRAMVRENIVTPSNFIYPLFIHDEDFCQDISSM
PGCQRHSLPSMLNEVGEALELGVKAFVLFPKVDDALKTNLACEAYNPEGIVHRSIRMIKE
KYPEAIVCTDVALDPYSDQGHDGVVEDGVILNDVTVNQLCKQAVSQARAGADIVAPSDMQ
DGRVKAIRDALDSEGFTNVSILSYTAKYASAYYGPFRDALDSHPGFGDKKTYQQDPANGR
EALIEAALDAAEGADMLMVKPGMPYLDIIRRLKDNSDLPIAAYHVSGEYAMLKAAVEKGW
LDEKAVVLETLTCFKRAGADIILTYYAKQAAKWIKEDGLY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcactctcctcgccatcacactcgcatgcagcaatgcctttgctcccgtttct
gtgtcaagaacaaccagcctttccatgggagctggaaacatggagcctgttgaccgaacc
atgaatggtatcgatgacaatcttggatacgaggcgtttgatcctactgctggcgaaaat
ccagctgttgcaaggaacaatcagggtggcgtttgggttcagcagcgtgctcgtccacgt
cgcaaccgtaaatctgctggagtccgtgccatggttcgtgaaaacattgtcactccctcc
aacttcatctaccctctcttcatccacgacgaggacttttgccaagatatttcttcaatg
cctggatgtcagcgtcattctttgccttccatgcttaatgaggttggagaggctttggag
ttgggagttaaggcgttcgtgttgtttcctaaggtggatgatgctttgaagacgaacttg
gcatgtgaggcttacaatcctgagggaattgtgcatcgttctattcgcatgattaaggaa
aagtatcctgaggctatcgtttgtaccgatgtggcgttggatccttattctgatcaggga
catgatggtgttgttgaggatggagttatcttgaacgatgttaccgtgaaccagctttgc
aagcaggctgtttcgcaggctagggccggagctgatatcgttgctcccagtgatatgcaa
gacggacgtgtcaaagctattcgtgatgctcttgactctgagggcttcaccaatgtttcc
atcctctcctacactgccaaatacgcttctgcatactatggacccttccgtgatgctctt
gactctcaccctggattcggagacaaaaagacttaccaacaggatcctgcgaatggacgt
gaggcactcatcgaagctgctcttgatgccgctgagggagctgatatgctcatggttaag
cctggaatgccttatttggacatcattcgtaggttgaaagacaactctgatttgcctatt
gctgcctaccatgtcagtggagagtatgccatgttgaaggctgctgttgagaagggatgg
ttggacgagaaggctgttgttttggagactttgacttgcttcaagagggctggagcagat
atcattcttacatactacgcaaaacaagctgccaagtggatcaaggaggatggactttat
taa

DBGET integrated database retrieval system