KEGG   Thalassiosira pseudonana: THAPSDRAFT_270359Help
Entry
THAPSDRAFT_270359 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THAPSDRAFT_270359
Enzymes [BR:tps01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     THAPSDRAFT_270359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 1414 aa AA seqDB search
MKKALIYIYCFGSATAFVPGGGRSVALRPSQLSPTQTHPLALEDPRRKSSTSILSSLLSK
EDVTASTPESINSPDTINVVLVTGFESFNRDLYEQSAALLPPELSVNLSVFSDSDIRTSK
RFASAVQTADIFIGSLIFDYDDVVAVSKLLDNVRGPRLVFESATELMTYNRVGKFSMETA
GDEPSGPPPAIKAVLNKFSSGKEEDKISGYLKMLKFGPDLLKYIPGEKASDLRTWLESYR
FWNQGGVNNVKAMLQIIAQQYLLEKSNGKSKEIESLPVPELEVTPDVGLIHPLQLAKQHK
FKLAPNDAPRIAILLYRKHVITNQRYIQDLIRMFEEQGFVPVPVFINGVEAHTIVRDWLT
SQHEIDGVKKREIVRDATYKPSEALEVDGIVSTIGFPLVGGPAGSMEAGRNVDIAAKLLE
SMDVPYIVASPLLLQSIPIWKSNGVLGLQSVVLYSLPELDGAIDTVVLGGLVGDKIALVP
ERVRKLCNRLRGWIDIRKTPPSERKVTIMLYGFPPNVGAVGTAALLDVPSSLENLLRRLH
DEQYNVGEFATDPNASGQSLVAALSILCESSVIAGGAARMQTVIEQRMRRASDGDATVPE
TLANPGGGLGGAKVKGADMNFDDLEKMMGKLMSKKVRRAWPESERGPGINAKGEMTVAGL
ELGNIFITVQPLLGVEGDPMRLLFERDLTPHPQYCAAYEWMRLPEDLGGAGAQAVIHLGM
HGTVEWLPGQPLGNDRQSWSDEMLGGLPNIYVYAANNPSESILAKRRGYGTLVSYNVPPY
GRAGLYLELANLKDLVNEYRTGETTSSKNRSDLRESIFASCERTGITSDVPLSGNIDSLD
SLSDELFDDWVARVSNYLVELEERLFSSGLHSLGSQPTDEELRSYLNAYFCDRLTEDEIK
HVISARHTDNIKHQWWPSFVSWLQEFSSSFVDTDGRDSSQDVQSVNVTEKVSLTREARDI
VTLLSKNTEEMSSVINALNGGYILPAPGGDLLRDGTSVLPTGRNIHALDPYRMPSAGAWA
RGERAAAEIIKQHKEANNGAYPGTVAVTLWGLDTIKTRGESIAIVLSLVGARPVKEGTGR
TVNYELIPLEELGRPRIDVLASLSGIFRDSFANVVDLLDDMFERAAIADESPDMNYIKMH
SMELEAEGNDRPAARLFSNPPGDYGSMVNEVVGTGDWDESEKLGEIWKGRNAYSYGRNEG
GGGTRSGTARPQVLDKLLSTTERVIQEIDSVEYGLTDIQEYYANTGALKKAAENRKEIES
STGKKKKVAVSVIEAFGGGVSGNDTVQVKDVEDVLRLEYRSKFLNPKWRDAMLQQGSGGA
YEVSQRMTAMVGWAATADVDNFVFDQAAERYALDEEVASKLQKSNPEAFKNVVRRLLEAN
GRGMWDTDDETIEKLRNLYSDADDLVEQVASSFG
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagcattaatttacatctactgcttcggttcggcaactgccttcgtgccgggc
ggcggtagatctgtcgctctaagaccatcacagctctctccaacacaaacacacccttta
gcactggaggacccaagacgaaaatcgtcgacctccatcttatcctctctattatccaaa
gaagacgtgaccgcatcgacacctgaatccatcaattcacccgataccattaatgttgtt
ttagtgacgggctttgaaagcttcaacagagatctatacgaacaatcagcagcgttgcta
ccaccagaactgtctgtcaacctgtcagtgttttcagactcagatatcagaacatcgaag
cgatttgcaagcgctgttcaaactgcagatatattcatcggatcactcatatttgactat
gatgatgtagttgccgtttccaagctactcgacaatgtacgtggacctcggcttgtattc
gaaagtgctaccgaactcatgacttacaatagagttggtaaattcagcatggagacggct
ggagacgaaccatcaggtcctcctcctgcaatcaaagcagtactgaacaagttttcatcg
gggaaggaggaagacaagattagtggctatctcaagatgctcaagtttggtccagatctg
ttgaagtacattcctggagaaaaggctagtgatctgaggacgtggcttgaatcgtatcgg
ttttggaaccagggaggagtaaataatgttaaagcaatgctccagatcattgcacaacaa
tatcttctggagaagagtaatggcaagtcaaaagaaattgagtctctcccggtaccagag
ttggaagtgactccagatgttggactaatacaccctcttcaacttgcgaagcaacacaag
ttcaaacttgcacccaatgatgcacctcgcattgcaatccttctatatagaaagcacgta
atcaccaaccagaggtatattcaagatttgatccgtatgtttgaagaacaagggtttgtt
cccgttcctgtctttatcaatggcgttgaagctcacaccatcgtgagagattggctcact
tcccagcacgagatagacggtgttaagaagagggagatagtacgagatgcaacgtacaaa
ccgagtgaagcgctagaagttgatggaatagtttctacgatcggtttcccccttgttgga
ggaccggctggcagtatggaggctgggagaaacgttgacatcgcagcgaaacttttggag
agcatggacgttccctatatagttgccagtcccttattactacaaagcataccgatatgg
aagtcgaacggcgtattggggttgcaatccgtggttctttattcgttgccagagctggat
ggtgccatcgatactgtcgttcttggagggttggtaggggacaagattgcactcgtgcct
gagcgagtgcggaagctgtgcaatagactacgaggctggattgacattagaaagacgccg
ccttcagagcgtaaggtgacaatcatgctctatggctttccaccaaacgtgggagcggtc
ggcactgcagctttgcttgacgtgcccagctccctggagaatttgctcagacgattgcac
gatgaacaatacaatgttggtgagttcgccacagatccaaatgcaagtgggcagtctttg
gtggctgcactatcaattctttgtgagagttcagtaatagctggcggtgctgcgagaatg
caaacggtaatcgagcaacggatgagacgtgccagtgacggtgacgcaactgtacctgaa
acacttgcaaatcctggtggtggactgggaggtgccaaagttaaaggagctgacatgaac
tttgatgacttggagaagatgatgggaaagttaatgtcaaagaaagtgaggagggcatgg
ccagagtccgagcgaggccccggtatcaatgccaaaggtgaaatgacagttgcaggacta
gaactaggcaacatattcattacggttcagcctcttttaggcgttgaaggggacccgatg
aggctgctatttgaacgcgacttgactcctcaccctcagtattgtgccgcgtacgagtgg
atgcggttgccagaggatttgggcggtgctggagcccaggcagtgattcatctcggtatg
catgggactgtagaatggctacctggacagcctctaggcaatgataggcagagctggagc
gacgagatgcttggaggactgccaaacatttacgtgtacgcagctaataaccccagtgaa
agcatcttggcaaagcgaagaggatatggtacacttgtgagctacaacgtacctccgtat
ggcagagcagggctgtacttggaattggcaaacctaaaagatctcgtcaacgaataccgt
acaggcgaaacaacatcttcaaagaacagatctgatctccgagaatccatctttgcatcc
tgtgaacgaactgggattacttccgatgttccactgagtggtaatatcgactcgttggat
tctttaagcgacgaattgttcgatgattgggtggcacgtgtctcaaactatctcgttgag
ctggaagaaagattgttctctagtggattacattcacttggcagccagccaactgacgag
gagctgcgctcatatttgaatgcttatttttgtgatagacttacggaggatgagataaag
cacgttatttcggcaagacacacagacaacataaagcatcaatggtggccgtcatttgtt
tcgtggctgcaagaattctcgtcaagctttgtggataccgatggccgcgatagttcacaa
gatgtgcaaagtgtcaacgtcacggagaaagtatcgttgacgagagaagcaagggatatt
gtcactctgctatccaaaaacacagaagaaatgtcttccgtgatcaacgctctgaacggt
ggatatattcttcctgctcctggtggcgatctgctcagagatggcacatcagtactcccc
actggtcgtaacattcatgctttggatccctatcggatgccatcagcaggtgcgtgggca
agaggagagagagcagctgcagaaatcattaagcagcacaaggaagcaaacaatggggcc
tatcctgggacagtagccgtcacactttgggggttggatactattaaaacaagaggagaa
agcatagccattgtactgtcattggttggagcaagaccagtgaaagagggcaccggcaga
actgtgaactatgagctgataccgttggaagaactaggcagaccacgcattgatgttctc
gcgtcgttatcaggaatcttccgcgattcatttgctaatgtagtcgacctattggacgat
atgttcgagcgggcagcaatcgctgatgagtctccagacatgaattacataaagatgcac
tctatggagctggaggcggaaggcaatgaccgaccagctgctcggctctttagcaatccg
cctggggactatggaagcatggtaaacgaggttgtaggaacgggtgattgggatgaaagc
gagaaactcggcgagatatggaaggggcggaatgcgtactcgtatggacgaaatgaaggg
ggaggaggaactcgatcaggtacagctcgtccacaagtactggataaactattgtcgacg
accgaaagagttattcaagagatagactcagtggagtacggactcaccgatatccaagag
tactacgcaaacactggagcgctgaagaaagccgccgagaatcgcaaagagatcgaaagc
tctacaggaaagaagaaaaaggtagcagtatcagttattgaagcctttgggggaggtgtc
tctggtaatgatacagtccaggtcaaagatgtggaagatgtattgagactagaatatcgc
tcaaagtttctaaatcccaagtggagagatgcaatgctgcagcaaggaagtggtggtgct
tacgaagtgtctcagcggatgacggcaatggttggatgggcagcaacagctgatgttgac
aacttcgtttttgatcaagccgcagaacggtacgccctcgacgaggaggtcgcaagcaag
ctacaaaagagcaatcccgaagcattcaagaatgttgtgcgacgtcttctagaagcaaac
ggcagaggaatgtgggatactgatgacgaaacaatagagaaattgaggaatctttacagc
gacgcggacgatcttgttgagcaagtggcatcgtcctttgggtag

DBGET integrated database retrieval system