KEGG   Thalassiosira pseudonana: THAPSDRAFT_28350Help
Entry
THAPSDRAFT_28350  CDS       T01078                                 

Gene name
PGAM1
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00010  Glycolysis / Gluconeogenesis
tps00260  Glycine, serine and threonine metabolism
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01130  Biosynthesis of antibiotics
tps01200  Carbon metabolism
tps01230  Biosynthesis of amino acids
Module
tps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tps_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_28350 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THAPSDRAFT_28350 (PGAM1)
Enzymes [BR:tps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     THAPSDRAFT_28350 (PGAM1)
Membrane trafficking [BR:tps04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    THAPSDRAFT_28350 (PGAM1)
Exosome [BR:tps04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   THAPSDRAFT_28350 (PGAM1)
  Exosomal proteins of melanoma cells
   THAPSDRAFT_28350 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 7453216
NCBI-ProteinID: XP_002290750
JGI: 28350
UniProt: B8C354
Position
5
AA seq 293 aa AA seqDB search
MKSSTLLFLLASIGSTSGFVAPVTRTTFTANPTCTELYNHKLVLVRHGESTWNDLNIFTG
WADADLNEKGKAEALAGGKLIKEAGFTFDVAYTSVLKRAIKTLWIILEEMDLMYIPIVNT
WRLNERHYGGLQGLNKQETVDEYGKDQVLIWRRSYDIPPPECDESSEYYPGNDPRYANVD
KADLPKTESLKLTEDRFMPVWENEIAPAIKSGKKVLIAAHGNTLRALVKHLDNISSDTIA
ELNIPTGVPLVYELDDDLNVVPNENAIAPLQGMYLGNLDDVKARIAGVANQTK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctccactcttcttttcttgttagcatccatcggatcaacatctggcttcgtc
gctcctgtcacacgaacaacattcacagccaaccccacctgcactgaactctacaaccac
aaacttgtactcgtgcgtcacggtgaatcaacttggaatgacctcaacatctttactgga
tgggcggatgctgacttgaacgaaaagggaaaggcagaggctttggctggtggaaagctc
attaaggaggcaggattcacttttgatgttgcctacaccagtgtgttgaagagggcgatc
aagacactctggattatcttggaggagatggatttgatgtacattcctattgtcaacacc
tggcgattgaatgaaagacactacgggggtcttcaaggactcaacaagcaggaaactgtc
gatgaatatggcaaagaccaagtcctcatttggcgtcgcagttatgatatcccacctcct
gaatgcgacgagtcaagtgaatactaccccggaaacgaccctcgttacgccaacgttgac
aaagcagacttgcccaaaactgagagcttgaaactcactgaagatcgcttcatgcctgtg
tgggagaatgagattgcccctgcaatcaagagtgggaagaaagtgttgattgctgcccat
ggtaatactcttcgtgctcttgtgaagcatttggacaatatctcgtcggatacgattgcg
gagctgaatatcccaacaggtgtgcctctcgtgtatgagttggatgatgatctgaatgtg
gtacccaacgagaatgcgattgctcctttgcaagggatgtacttggggaacttggatgat
gtcaaggcaaggattgctggagttgcgaatcagacaaagtag

DBGET integrated database retrieval system