KEGG   Thalassiosira pseudonana: THAPSDRAFT_2942Help
Entry
THAPSDRAFT_2942   CDS       T01078                                 

Definition
hypothetical protein
Orthology
K16172  
insulin receptor substrate 1
Organism
tps  Thalassiosira pseudonana
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 1964 aa AA seqDB search
MHGRPRVSINSPIFFTHLLFSNLIFTFHSSCTTKPSSAPSDSPSASGAPSSQPSDSPSSS
GQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPT
SMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPS
DSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSLGQPTSMPSDSPS
LSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGK
PSSAPSGSPSRSVEPLSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSA
PSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSSSLSGKPSSAPSGS
PSRSVEPLSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRS
VEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPS
SAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPS
DSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPS
ASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGA
PSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQ
PSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDS
PSSSGQPTSMPSDSPSSSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSS
GQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPT
SMPSDSSSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPS
DSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPS
SSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGK
PSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSSSGKPSSA
PSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGS
PSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRS
VEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPS
SAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPS
DSPSASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPS
ASGAPSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGA
PSSQPSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQ
PSDSPSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDS
PSSSGQPTSMPSDSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSDSGAPSSQPSDSPSSS
GQPTSMPSDSSSLSGKPSSAPSGSPSRSVEPSSAPSDSPSDSGAPSSQPSDSPSSSGQPT
SMPSDSSSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPS
DSPSLSGKPSSAPSGSPSRSVEPSSAPSDSPSASGAPSSQPSDSPSSSGQPTSMPSDSPS
LSGKPSSAPSGSPSHSVEPPPTAIPSTLHPTKVPTVRPFFVVVL
NT seq 5895 nt NT seq  +upstreamnt  +downstreamnt
atgcatggccgtccacgtgtctcgatcaattcacctatcttcttcactcacctcctcttc
tctaatctaatcttcactttccactcctcgtgtaccacaaagccgtcgtctgctccaagt
gacagcccgtctgcctctggagctccatcatcgcagccttccgactcaccgagctcatca
ggacaaccaacgtctatgccctcagactcgccatcgttgtctggcaaaccaagcagtgct
ccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtct
gcctctggagctccatcatcgcagccttccgactcaccgagctcatcaggacaaccaacg
tctatgccctcagactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcg
cccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagct
ccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacgtcaatgccctca
gactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagt
gtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagctccatcatcgcag
ccttccgactcaccgagctcattaggacaaccaacgtctatgccctcagactcgccatcg
ttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcg
tctgctccaagtgacagcccgtctgcctctggagctccatcatcgcagccttccgactca
ccgagctcatcaggacaaccaacgtctatgccctcagactcgccatcgttgtctggcaaa
ccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgttgtctgctccaagt
gacagcccgtctgcctctggagctccatcatcgcagccttccgactcaccgagctcatca
gggcaaccaacgtcaatgccctcagactcgccatcgttgtctggcaaaccaagcagtgct
ccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtct
gcctctggagctccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacg
tcaatgccctcagactcgtcatcgttgtctggcaaaccaagcagtgctccgtccggatcg
cccagtcgtagtgtagagccgttgtctgctccaagtgacagcccgtctgcctctggagct
ccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacgtcaatgccctca
gactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagt
gtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagctccatcatcgcag
ccttccgactcaccgagctcatcagggcaaccaacgtcaatgccctcagactcgccatcg
ttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcg
tctgctccaagtgacagcccgtctgcctctggagctccatcatcgcagccttccgactca
ccgagctcatcagggcaaccaacgtctatgccctcagactcgccatcgttgtctggcaaa
ccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagt
gacagcccgtctgcctctggagctccatcatcgcagccttccgactcaccgagctcatca
gggcaaccaacgtctatgccctcagactcgccatcgttgtctggcaaaccaagcagtgct
ccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtct
gcctctggagctccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacg
tcaatgccctcagactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcg
cccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagct
ccatcatcgcagccttccgactcaccgagctcatcaggacaaccaacgtctatgccctca
gactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagt
gtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagctccatcatcgcag
ccttccgactcaccgagctcatcagggcaaccaacgtcaatgccctcagactcgccatcg
ttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcg
tctgctccaagtgacagcccgtctgcctctggagctccatcatcgcagccttccgactca
ccgagctcatcaggacaaccaacgtctatgccctcagactcgccatcgtcgtctggcaaa
ccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagt
gacagcccgtctgcctctggagctccatcatcgcagccttccgactcaccgagctcatca
gggcaaccaacgtctatgccctcagactcgccatcgttgtctggcaaaccaagcagtgct
ccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtct
gcctctggagctccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacg
tctatgccctcagactcgtcatcgttgtctggcaaaccaagcagtgctccgtccggatcg
cccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagct
ccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacgtcaatgccctca
gactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagt
gtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagctccatcatcgcag
ccttccgactcaccgagctcatcaggacaaccaacgtctatgccctcagactcgccatcg
tcgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcg
tctgctccaagtgacagcccgtctgcctctggagctccatcatcgcagccttccgactca
ccgagctcatcagggcaaccaacgtcaatgccctcagactcgccatcgttgtctggcaaa
ccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagt
gacagcccgtctgcctctggagctccatcatcgcagccttccgactcaccgagctcatca
ggacaaccaacgtcaatgccctcagactcgccatcgtcgtctggcaaaccaagcagtgct
ccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtct
gcctctggagctccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacg
tctatgccctcagactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcg
cccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagct
ccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacgtcaatgccctca
gactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagt
gtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagctccatcatcgcag
ccttccgactcaccgagctcatcagggcaaccaacgtctatgccctcagactcgccatcg
ttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcg
tctgctccaagtgacagcccgtctgcctctggagctccatcatcgcagccttccgactca
ccgagctcatcagggcaaccaacgtcaatgccctcagactcgccatcgttgtctggcaaa
ccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagt
gacagcccgtctgcctctggagctccatcatcgcagccttccgactcaccgagctcatca
ggacaaccaacgtcaatgccctcagactcgccatcgttgtctggcaaaccaagcagtgct
ccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtct
gcctctggagctccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacg
tcaatgccctcagactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcg
cccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagct
ccatcatcgcagccttccgactcaccgagctcatcaggacaaccaacgtctatgccctca
gactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagt
gtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagctccatcatcgcag
ccttccgactcaccgagctcatcagggcaaccaacgtcaatgccctcagactcgccatcg
ttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcg
tctgctccaagtgacagcccgtctgcctctggagctccatcatcgcagccttccgactca
ccgagctcatcaggacaaccaacgtctatgccctcagactcgccatcgttgtctggcaaa
ccaagcagtgctccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagt
gacagcccgtctgactctggagctccatcatcgcagccttccgactcaccgagctcatca
gggcaaccaacgtctatgccctcagactcgtcatcgttgtctggcaaaccaagcagtgct
ccgtccggatcgcccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtct
gactctggagctccatcatcgcagccttccgactcaccgagctcatcagggcaaccaacg
tctatgccctcagactcgtcatcgttgtctggcaaaccaagcagtgctccgtccggatcg
cccagtcgtagtgtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagct
ccatcatcgcagccttccgactcaccgagctcatcaggacaaccaacgtctatgccctca
gactcgccatcgttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcgtagt
gtagagccgtcgtctgctccaagtgacagcccgtctgcctctggagctccatcatcgcag
ccttccgactcaccgagctcatcagggcaaccaacgtctatgccctcagactcgccatcg
ttgtctggcaaaccaagcagtgctccgtccggatcgcccagtcatagtgtagagcctcct
ccgacggcaattccaagtactcttcaccccactaaggtaccaactgtaagaccttttttt
gttgtcgttttgtaa

DBGET integrated database retrieval system