KEGG   Thalassiosira pseudonana: THAPSDRAFT_29771Help
Entry
THAPSDRAFT_29771  CDS       T01078                                 

Definition
phosphatidylinositol 3-kinase (PI3K)-like protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tps  Thalassiosira pseudonana
Brite
Protein kinases [BR:tps01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   THAPSDRAFT_29771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 2421 aa AA seqDB search
MPHEKFVAVESEVYAKLFSLVHSKTIRADERLAGVAALDALLSVPSFDEEKKAIRFGNNL
SHGLKAAYADYEFLHAVARALGRMAMGAANVDRVEFEIGRSLEWLRSDRSDRRLAAVLVL
GELARCAPTAFYSKTHNFLDHIFPVLRDPQPIVRVCAADALSECLQILMERQHRNMTASL
LEVGDKDSVAYANTTAVHSHGSLLVVSSIVNHSRNFILPRFDEVCTAVLSFMDHPMILIR
LEVVRLIPKLAQRCPGVYGRRYLEESLDFLISCAATSPPPKGVDMRPTAFSAIGQLAMAM
SDEELGGGDISIPTVRIAQMIATSSQCDVLGCFSNMVEALGQQSAAYVPELVEDLFEAGL
SEDLIKCLHSIAASLPSEQSTIERRLFEEISSCLAGTKTLDVISNLYSTQRNVRPSLTSF
GSASMLVDSSPLETSRPALEKSFMSSMSLSSMNPKNGNMLLPFLQSVISMYLVHPSNDVR
REAAIACCMLLLPFDSRNAEKQAEKGDTLLDYNLGNVSGSLMEEVLQKLLRMAVSDLSPI
VRLCVVRGLDERYDSYLCQLNLLPPLFLMLEDEALAVRACALQLLGRLSRLNPAPILPGL
RRVLVELIIELRCGGDNSGGREAATRLIVVFLREEALRRLVRPFISSIIDALPLSNVAPR
LVSTSLEALGELATVGNSSISMLRQLIPHILKNMQDQNSSKQRVSLWTMGKIAYGTSYVV
VPYLEYPQLLSQASDVLPTTKRAPWYLRREVFRMFGILGALDPDRFLPYKIRKGGGVGGG
YFVELEDDDTGIPLSNLPPARRLLPSDDDFYPTVAVQALMRILKNPSLSNLHGMVMKAVM
FIFNALGLRSVPFLKQIVPHILSTIKSCGQPGLREALLQQISSLSAIVREHLRPYLPAIF
DVVEEFWFTRHLSALCSLVERVATAVPDDFRIYVPLLVRLVLASVEAIDVTEWSNSSASI
EIERLDLILKFTQGIKGVLGEYIHLVVPALVNLTDTVETLSILLQTVEITSNACVESMVK
SNSALPARVVQPFLRMLGGEVSPNKAVGNALVESICICVRQLGAGRWMSFYHVSCYEIIG
NWQRKLGIELPAVAGAEKGARSGASDVSLTGIGDSLKPPTRNAPSIQPIVHQTTAHRVNL
SNLQKSWDVSQKSSREDWDEWMRRFSIQLLREAPSPALRACAELAQAYSPLARELFSAAF
VCCWTELNEQYRSNLVFSLETVYSADASLEILQLLLNLAEFMEHDVDLGGTNSGLPINIS
VLADLALKCRAYSKALHYKEREYINGRSGSCVEQLIDINKKLDLPEAALGVLKAAKIEIE
RQGGQTLTPSHNHVVYESWLAKLGSWAEALSMYEQKLSENPYDVNSILGCMQCYDARGEW
QRALELAERSWGAISGESKKRTSSHNHRKALKFCAQAAWRLGKWDELETGSKASDPKLGF
DGAFYRAVLHIHRAEWDEANSAIDAARKAMDSRFTALLAESYKRAYPSMVAAQTLSELEE
IISYRQFEIRTFNGAHLHAANRPDATVAKNHLLDVWRRRLDGCRVDAEVHSSILAVRSLV
LGPTDDVDATITLAALSRQAEAFRLAERTLLDPLAQMEIVLTTTDRLFRLFIQHKLYFAY
VKNLWATDRRDDALARLGLLCNVVDTPQSEALRVSCWLRYGDWKVALNPLGENLPDSLAE
DVLVSYKRATDAGSKNYRAWHSWALINFRLAEQIHGMEKEQGGGMSGTTSSILLQSHVIA
AVKGFVLAISMGTKRWSASVQQDMLNLLSCLFKYGELRDVSKTINEGLVSIKIEAWLGVL
PQLLARIHIKAPSVRSVLHPLLVRLGAKHPQALMYPLSVLLKSPVLDRKLAAESLMNSLK
AHSNALVEEARMVSTELIRVAILWLELWHEGLEDASRLYYGEGNVSAMLDVLIPLHQQLE
KGASTRREQDFLKSFGRDLLDAHKHIKDYAEAALNQAWDLYYTVFRRINKQLPGMTTLEL
NQCSPALYNARNLELGVPGSYRVDGSYVKIERFITSVQVITSKQRPRKIIIRGNDGKDYV
FLLKGHEDLRQDERVMQLFGLVNALLARDRRTNKHDLNIQRYAIAPLSHNAGVVGWVPHC
DTLHCLIRDYRESLKVPLNAENREMMALAPNYDSLTAMQKVEIFTEALDKTAGKGNDLYE
VLWIKSTNSEEWLERRTNFTRSLAVMSMVGYILGLGDRHPSNLMLDQVSGRVLHIDFGDC
FEVAMHREKFPEKVPFRLTRMLTRAMEVSGIEGSYRSTCERTMAVLRDNKDSLVAMLEAF
VYDPLISWRVRVLSSLKMYSEMRALAANLSTSSRIQSITGGTDPTVERGSTARSRIDKSM
KQRELMSFLDGDEGDANEEALNEKALKVIRRVQDKLAGTDFHGPDEVGEPLDVPEQVQRL
IVQATSSENLCQLFIGWCAFW
NT seq 7266 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatgaaaagtttgtcgcagtcgaatcagaagtctatgccaaattattctcctta
gttcattcaaaaactatccgtgccgatgaacgtctggcaggagtggctgcacttgatgca
ttactctcagtaccatcctttgacgaagagaagaaggcaatccgctttggaaacaatctc
agtcatggactcaaggctgcctatgccgattacgaatttcttcacgctgtagccagagcc
cttggaaggatggcaatgggtgcagccaatgttgaccgtgtagagtttgaaattggacgt
agtttggagtggttgaggtccgataggagtgatcgacgactggcagccgtgttggtactg
ggggagttggcacggtgtgcacccacggcattttatagcaagactcacaactttttggat
catatctttccggtgttgagagaccctcaaccgattgtgcgcgtctgtgccgcagatgca
ctatcggagtgtctacaaattttgatggagcgtcagcataggaacatgacagcttctttg
cttgaagtgggtgacaaagactcggtagcttatgcaaataccacggccgttcattctcac
ggctctcttctcgtggtcagctccatcgtcaatcattcaaggaacttcatcttgcctcga
tttgacgaagtttgtactgcagtattaagttttatggatcatccaatgattctaattcgc
ttggaagtggtgcgtctcattcccaaactagctcaacgctgcccgggagtatacggacga
aggtatttagaggaaagcctggactttttgatctcgtgcgctgccacatctcctccacca
aaaggggtagacatgagacctacggcattctctgctattggacagcttgcaatggccatg
agcgacgaagaattgggaggtggagatatctctataccgactgtgaggattgcacaaatg
attgctaccagttctcaatgcgacgtgcttggttgtttttccaacatggttgaggcactt
ggtcaacagtctgctgcctatgtgcctgagctggtagaggacttgtttgaagccggattg
agtgaggacctcattaaatgtcttcattccatcgcggcgagccttccgtcggagcaatcg
actattgaacggcgtctgtttgaagagatatcttcatgcttggcaggtacaaagacattg
gatgtgattagcaatttgtattcgactcaacgaaacgttaggccatcgctgacatctttt
ggatcagcttcaatgttggtggattcttctccactcgaaacatcgcgacctgcattggaa
aagagctttatgagctcgatgtctctatcgtcgatgaatccaaagaatggcaacatgcta
ctgcctttccttcaaagtgtgatatccatgtacttggttcatccatccaatgatgtaaga
cgagaagcggctattgcatgctgcatgctactgctgccattcgatagtagaaatgccgag
aagcaggcggagaagggagatactcttcttgattacaacctggggaatgtgtcgggatca
ttgatggaggaggttctgcagaaactattgcgcatggcagtttcagatttgtcacccatc
gtgcggctttgtgtagtccgcggattggatgaacgttacgactcgtatttgtgccagctg
aatcttctcccaccgctgtttttgatgctggaagatgaagcattggcagtgagagcatgt
gcattgcaattactagggcgtctgtctcgtttgaatcctgctcccatcttgccaggattg
cggcgggtgctggtagagctcatcattgaacttcgttgcggtggagacaacagtggtggt
agagaagcagccactcgtctcatcgtggtgtttttgagagaagaggcgctgcgaagactt
gtacgtccattcatttcatcaataatcgatgctctccctctctcaaacgtagcacctcgt
ctagtatcgacgtctcttgaagccttgggtgaacttgcaaccgttggaaacagctcaatt
agcatgcttcgtcaactaattcctcacatcttgaagaacatgcaagatcaaaacagttca
aagcaacgtgtcagtttgtggacgatgggaaagatcgcctatggaacttcgtatgtcgtt
gttccatacttagaatatccacagcttctttcacaagcatcagatgtgcttccgactaca
aaacgagctccgtggtatcttcgtagagaggtgtttaggatgtttgggatactgggagcg
ctagatccggataggtttctgccctacaagataaggaaaggcggaggagttggtgggggg
tattttgtcgagttggaagatgacgataccggcattccattgtccaatcttcctcccgca
cgacgtctattgccatcggatgacgacttttatccaactgttgcggtgcaagctttgatg
cgtattctgaagaatccttcgttatcgaaccttcatggcatggtgatgaaggctgtcatg
tttattttcaacgcactcggattgcgtagtgttccctttttgaagcaaatagtacctcat
attctttccaccatcaaaagctgtgggcagccaggattacgtgaggctctattgcaacaa
atctctagtctgagtgccattgtacgtgagcatttgaggccgtatttaccagcaatattt
gatgttgttgaggagttttggtttacgaggcatctatctgcgttgtgctcgctagtagag
agagttgcaactgctgttcccgatgattttagaatttacgtgcctcttttggttcgattg
gtactggctagcgtggaagccatcgatgtcaccgagtggagcaactcttctgcatccatt
gaaattgaaaggcttgatttgatattaaagtttactcaaggaatcaaaggggtcttggga
gaatacatccatttggtggttcctgcacttgtgaacctcaccgacacggtagaaacactc
tcaattcttttacagacggttgagattacttccaacgcttgcgtcgagagcatggtgaag
tcaaacagtgctctccctgctcgtgtggtgcagccatttttgaggatgcttggaggtgaa
gtgtcaccaaacaaagccgttggtaatgctctagttgaatcaatctgcatttgtgttcgt
cagcttggagccggaaggtggatgtcgttctatcacgtcagttgttatgagattattggc
aattggcagagaaagttaggtattgaacttccagctgtagcgggagcagagaaaggtgct
agatccggggcatctgatgtgtctctcactggaattggagacagtttgaagccaccaaca
cggaatgcaccttcaattcaacctattgtacatcagacaacagcccatcgcgtcaacttg
tcaaatctacagaaaagttgggacgtgtctcaaaagtcctctcgagaagattgggatgag
tggatgagaaggttttccattcaactcctcagggaagcaccatcacccgctttgcgagct
tgtgccgagctagctcaggcatacagcccactcgccagagagctattcagtgctgctttt
gtttgctgctggactgaattaaacgaacagtacagatcaaatcttgtgttttcgttagag
acagtctattccgcagatgcatcgcttgaaatcttgcaactgctcttgaatttggctgag
tttatggagcacgatgtagatttgggtggtacaaatagcgggcttccaattaacatttcg
gtgttggcagacttggcattgaagtgtcgtgcttattccaaagccctccattacaaagaa
cgtgaatacattaatggaagaagtggatcgtgcgttgagcaactgattgatatcaacaag
aagctcgatctccccgaggctgcactgggagtgctcaaggcagctaagatagagattgag
cgacagggagggcagacgttgacgccatcgcacaatcatgtcgtgtatgaatcttggctt
gccaagctgggatcttgggccgaggctctgtcaatgtatgaacaaaagcttagtgagaac
ccgtacgatgtgaattccatattgggatgcatgcagtgttacgatgcgagaggtgaatgg
caacgagcattggaacttgctgagaggagttggggggcaatatcgggagagtcaaagaag
cggacgtcttcacacaatcatcgaaaggcattaaagttctgtgcacaagctgcttggagg
cttggaaagtgggatgaattggaaacggggagcaaagcgagtgatccaaaacttgggttt
gatggggccttctaccgtgcggtgttgcacatccacagagctgaatgggatgaagccaac
tcagcaattgacgctgctcgcaaggcgatggacagtcgcttcactgctcttcttgccgag
tcgtacaaaagagcatacccaagcatggttgctgctcagacgttgagtgaactggaagag
atcatatcatatcgtcaatttgagatacgaactttcaacggagcccatctccacgctgca
aatcgaccagatgcgacggttgcgaagaatcatcttttagatgtttggagacgtagactt
gacggatgtagggttgatgcagaggtgcattcgtcaatcctcgctgttagatcacttgta
ttgggaccaactgatgatgtagatgcgacaattactcttgcagctttgtcgagacaagcc
gaggcattccgattggcagagcgaacgctcttggatcctctcgcacagatggaaattgtt
ctaacaactactgatcgtctctttaggctcttcattcagcacaagctatactttgcgtac
gttaagaatctatgggcgacagacagacgagacgatgctttggctagacttggactactc
tgcaatgtcgttgacacccctcaaagcgaggcccttcgagtgagctgctggttgagatac
ggagattggaaagttgctctcaaccctcttggagagaatctaccggatagcctcgctgag
gatgtgttggtatcgtataaacgagcaaccgacgctggatccaaaaactatagagcttgg
cattcttgggcattgattaatttccgcttggcagagcaaattcatggcatggaaaaagag
caaggaggaggtatgagtggtaccacatcttcgatacttcttcaaagccacgtgattgcc
gcagtaaagggatttgttttagccatcagcatgggaacgaagcgatggagcgcgtctgtt
cagcaagacatgctcaatctgttaagttgtcttttcaaatacggtgaattgcgcgatgtc
tcaaagacaatcaacgaagggcttgtctccatcaagattgaggcgtggctgggagtcctc
ccgcaattgcttgcccgaatccacatcaaggcaccttcggttagatctgttcttcatcct
ttgcttgtccgtctaggagccaaacatcctcaggcgctgatgtatccactttcagttctg
ttgaagagtccagtattggatcggaagctcgctgccgaatctctcatgaattcgctcaag
gctcattcaaacgctttggtagaggaggctcggatggtatcaacggagctcattcgggtc
gccattctgtggcttgagttgtggcacgaaggtctagaggacgccagtcgtttgtactac
ggagaaggcaacgtttcggcaatgctggacgtcttgattcccctccaccagcagctggag
aagggtgcatccactaggcgagaacaagatttcttaaagagctttggaagagatctcttg
gacgcacacaaacacattaaagactacgcagaggctgcactcaatcaagcttgggattta
tactatacggtgtttcgaagaatcaacaaacagctgcctgggatgactacattggaactc
aatcagtgctctccggctttgtataacgcgaggaacttggaattgggagttcctggatcg
tatcgggttgatggcagttacgtcaagattgaacggttcatcacgagtgtacaagtcatt
acaagtaagcaacgtccacgaaagatcatcatcagagggaacgatggtaaggattacgtt
tttcttcttaagggacacgaggacttgcgacaagatgagagggttatgcaactgtttgga
ctcgtcaatgcactccttgcaagagaccggcgaaccaacaaacacgatttgaacattcaa
cgttacgccattgctccgttgtcgcacaatgctggagttgtaggatgggtgcctcattgc
gatactttgcactgtttgattcgtgattatcgcgagtcgctaaaagttcctctcaatgcc
gagaatagagagatgatggcgctggctcctaactacgacagcttgactgccatgcagaaa
gttgagatctttactgaggcactggacaagactgcaggcaaaggaaatgacttgtacgag
gtgttgtggataaagagcacaaacagcgaggaatggttggaaagaagaacaaacttcaca
cgttctctggctgtgatgagtatggtcggttatattctaggccttggagataggcacccg
tctaatctcatgctggatcaagtctctggtcgcgttctgcatatcgattttggagattgc
tttgaggtagccatgcaccgagaaaagtttccagaaaaagtgccgtttcggttgacacgt
atgctaacgcgagcgatggaagtctcgggcattgaagggagttatcgaagtacgtgcgag
cgaaccatggcagtattgagagacaacaaggattcgttggtggccatgcttgaagctttt
gtttacgatcctctcattagctggagggtacgtgttttgtcatcactcaagatgtattct
gaaatgagagctctcgcagccaacttgagtacatcctctcgtatccaaagcattactggc
ggtaccgatccaacagttgaacgaggatccacagctcgctcacgtatcgacaagagtatg
aagcaacgagagctaatgagcttcctcgacggggacgaaggcgatgccaatgaagaagca
ttgaatgagaaggcgttgaaagtgatccgacgagtgcaagataagcttgcgggtactgat
ttccacggtccagatgaggtaggagagcctttggacgtgcctgagcaagtgcagcgtttg
attgttcaagctaccagcagtgaaaatctttgtcaattgttcatcggctggtgtgcattc
tggtag

DBGET integrated database retrieval system