KEGG   Thalassiosira pseudonana: THAPSDRAFT_30963Help
Entry
THAPSDRAFT_30963  CDS       T01078                                 

Gene name
PKA
Definition
cAMP dependent protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     THAPSDRAFT_30963 (PKA)
Protein kinases [BR:tps01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   THAPSDRAFT_30963 (PKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 316 aa AA seqDB search
SIADFDIGVTLGTGSFGRVRFATHTGTNQHYAVKMLRKSDIIKYHQVEHIMSEKEILYDL
SIDHHPFIVNLAASFQDDCCIYMVIECVIGGEFFSYLRNAGKFNNQTSRFFAAHVVLIFE
HLHAKDIIYRDLKPENLLLDTDGYLKITDFGFAKKVAFKTFTLCGTPEYIAPEVLLNKGH
GKGVDWWTLGILMYEMMVGEPPFLDEDPMRIYQQILTGKISFTRSYDKYAKSLTKKLLTA
DLTKRYGCLKAGALDIKTSKWFNEIDWEALFGRKLQTPIKPKLSSAIDTSNFEEYPEDMD
DLEPPIFDGVDPFDAF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
tctattgcagactttgacattggtgtgactctcggaacaggatcgttcggtcgagtacga
tttgcaactcacaccggtaccaatcaacactatgcagtcaaaatgcttagaaagagtgac
attatcaaataccatcaagtggaacacatcatgtcagagaaggagattctatatgactta
tcgatagaccaccatcccttcattgtcaacttggctgcatcgtttcaagatgactgttgc
atatacatggtcattgagtgtgtcattggtggggagttcttttcatatctgcggaacgct
gggaaattcaacaaccaaacgtcgaggttctttgcagctcacgtggttctcatctttgaa
catctccatgccaaggatataatatatcgcgatttgaagccagagaacttgctcctcgat
actgacgggtatctgaagattaccgactttggctttgccaagaaggttgcattcaagacg
ttcactctctgtggcactccggaatatatcgcacctgaggttctgctgaacaaaggacat
ggcaagggagttgattggtggacactgggaatattgatgtatgagatgatggtcggcgag
cctcccttcttggacgaagatccgatgcgtatttaccagcaaatactgactggtaaaatt
agcttcacccgcagctacgacaagtatgccaagtcgttgacgaagaagctgctgactgcc
gatctgacgaaacgatacggctgtttgaaggctggtgcattagatatcaaaaccagcaaa
tggtttaatgaaatcgattgggaagctttgttcggcagaaagttgcaaacaccaatcaag
ccaaaactctctagtgccattgacacctccaactttgaagagtatccggaggatatggat
gacttggagccacccatctttgacggagttgatccgtttgacgccttctga

DBGET integrated database retrieval system