KEGG   Thalassiosira pseudonana: THAPSDRAFT_31907Help
Entry
THAPSDRAFT_31907  CDS       T01078                                 

Definition
4-diphosphocytidyl-2c-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tps  Thalassiosira pseudonana
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    THAPSDRAFT_31907
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     THAPSDRAFT_31907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 296 aa AA seqDB search
LKLFSPCKINLFLRIIRKRPDGFHDLASLFQAVGFGDTLTLSLSEQPNDEFTCNMEGVPT
DSSNLVLRALELMRQKTGKTDVYFKADLFKRVPAQAGLGGGSANAATAMWGANELMGKPA
TLGELIEWSGELGSDITFFLSRGTAYCTGRGEVMTPIDPPLPSGSKLSIVKPDLGLSTPK
VFSALDYEQLSAEDPEELLNTFLEFGVVDTDDEYYINDLEQPAFDCLPELKALKEDLLKV
KGFDHVMMSGSGTSIFCIGEADDKDAFMKEFDSREGVSVFNAEFINREDGCWFESP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ctcaaactattcagtccatgcaaaatcaacctcttcctacgcatcattcgcaaacgtccc
gatggatttcacgatcttgcgtctctctttcaagcggtaggatttggtgatactctcact
ttatctctatcagaacaacccaatgatgagttcacatgcaacatggaaggagtacccacc
gactcatccaatttggtactacgtgctttggagttgatgcgacaaaagactggaaagacg
gatgtgtatttcaaagcagacttgttcaagagggtgcctgctcaggctggtttgggtgga
ggatcggcgaatgcggcgacggcaatgtggggcgcaaatgagttgatggggaagccggcc
acgttgggagaactcattgaatggtcgggtgaactagggtccgatatcaccttcttcctc
tcccgaggaacagcctactgcacaggccgtggagaagtaatgacacccattgatccacct
ctaccctctggatccaaactatccatcgtcaaacctgatctgggactctcaacaccaaag
gtattcagtgcccttgactacgaacaattgagtgcagaggatccagaggaattgttgaat
acgttcttagaatttggggtagttgatacggacgatgaatactacattaatgatttggaa
caacctgcatttgactgcttgccagagctaaaggcattgaaggaagacttactgaaagtg
aaggggtttgatcatgtaatgatgtcagggagtggaacatcaatcttttgtataggcgag
gccgatgacaaggatgctttcatgaaggagtttgatagcagggagggggttagtgtgttc
aatgccgagtttatcaaccgagaggacgggtgttggtttgagagtccgtag

DBGET integrated database retrieval system