KEGG   Thalassiosira pseudonana: THAPSDRAFT_32098Help
Entry
THAPSDRAFT_32098  CDS       T01078                                 

Definition
histone deactylase 1 HDAC Hda1p HDA1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     THAPSDRAFT_32098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 419 aa AA seqDB search
MTATTAITTSGSTANKQRVSYFYQPDVGHFYYGPSHPMKPHRIKMAHHLILSYGMYRQME
CYKSHPASPSEMAAFHSEDYINFMAKVTPDNLRGFSNAMNRFNVGEYTDCPVFDGLFEFT
QLYTGASLDGAVKLNRGDCDIAVNWSGGLHHAKKSEASGFCYINDIVLAILEMLKVHARV
LYIDIDVHHGDGVEEAFYCTDRVMTFSLHKYGDFFPGTGHIKDTGAKEGTGFSVNAPLTS
GMTDGTYEKLFKPVLSKIMEVFQPGAIVLQCGADSLTGDRLGCFNLSLKGHAECVKFTKS
FNVPTLVLGGGGYTIRNVARCWAYETSVLLDMELPDEIPYNDYYEYYAPDFKLHLTPEQR
ENMNTEASLESVRVDLLTQLISLKGAPSVQMMEVPPDFEVIKEDLNAEKERKSTKEDRD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaacaacagccatcacaacaagcggcagcacagccaacaaacagcgcgtctcc
tacttctaccaacccgacgtaggccacttctactacggtccctcccacccaatgaagccc
caccgtataaaaatggcacaccatctcatcctctcgtatggaatgtatcgacaaatggaa
tgctacaaatctcatcctgcgtctcctagcgagatggcggcgtttcattccgaggactac
atcaacttcatggccaaggtgactcccgataatttgagggggttcagtaatgcaatgaac
cggttcaacgtgggggaatacacggattgtccggtctttgatggattgtttgagttcacc
cagctgtataccggggcaagcttggacggagccgtcaagttaaaccgcggtgattgcgac
attgccgtcaattggagcggggggctgcaccacgccaagaagagcgaggcttctggattc
tgctacataaacgacatcgtactggcgatattggaaatgctcaaggttcacgcccgagtg
ctctacattgatattgacgtgcatcacggggatggagtcgaagaagcgttctactgcacc
gaccgcgtcatgacgttcagcttgcacaaatacggagactttttccccggcacgggacac
attaaagatacgggtgccaaggaaggaacgggcttttcggtcaatgccccgttgacttcg
ggaatgacggacggtacctatgaaaagttgttcaaaccggtgttgagtaaaattatggag
gtgtttcagcccggagcgattgtattacagtgtggtgccgactctttgacgggggatcga
cttgggtgcttcaaccttagtttgaagggacatgcggagtgtgtcaagttcacaaagagc
tttaatgttccgacgttggtgttgggtggaggagggtatacgattcgcaatgtggcacgg
tgttgggcatatgaaacgtcggtattgttggatatggaattgccagatgagattccgtac
aatgattactatgagtattatgctcctgatttcaagctccatttgaccccggaacaacgg
gagaatatgaataccgaggcttcgctggagagtgttcgggtggatctgttgacacagctt
attagtctcaagggtgcaccgtcggtgcagatgatggaggtgccgccggattttgaggtg
attaaagaagatttgaatgcggaaaaggaacgaaagtcgactaaggaggatagagac

DBGET integrated database retrieval system