KEGG   Thalassiosira pseudonana: THAPSDRAFT_32230Help
Entry
THAPSDRAFT_32230  CDS       T01078                                 

Gene name
MAPK
Definition
mitogen activated kinase-like protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     THAPSDRAFT_32230 (MAPK)
Protein kinases [BR:tps01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   THAPSDRAFT_32230 (MAPK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 402 aa AA seqDB search
DFEQWDVGDRYQLKKMLGRGSYGEVAQATDLLAPTPQHRNATFVAVKKISKAFDQEVDAV
RLFREMHILRRLSGHECIIQLVDVVQPSSADEKLFSDLYLVFEFVDTDLYKLIMSPQYLT
TEHIQTFLYQMLVGLKYIHSSSVIHRDLKPAILLNEDCTLKICDFGLARIVHHEKIQPTP
STTSSDDGAGVATVNDRSTVPMTTPTEMDRDQLKSIPRPNLSRQLTKHVVTRWYRAPELI
LIQPYASAVDIWSLGCIFAELLSMQEGSVPSYQDRVPLFPGGSCFPLSGDKGTKGATGSD
ERLDQLSVIFSVIGMPSEEDLQSVGKANDYIKSLDKKPGRNIESLYPAADPEAINLLKTM
LMFNPAKRCTADEALEHEFLKPVRCKAREVRMVQSTSYLVRE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gactttgagcaatgggatgtaggagatcgctaccagttgaagaaaatgctgggtaggggg
tcttacggtgaggtagctcaggcgacagacttgcttgcacccactcctcaacatcgcaat
gcgacatttgtggctgtcaagaagatttccaaagcgtttgatcaggaagtggacgcggtg
cgtctgtttcgtgaaatgcacatattacgtcggttgagtggccatgaatgtatcattcag
ttggtggatgttgttcaacctagcagtgcagacgagaaactcttcagtgatctgtatctt
gtatttgagtttgtggatacagatttgtacaagttgattatgtctcctcagtacctcaca
actgaacacatacagacgtttctgtatcaaatgcttgtggggctcaaatacatccattct
tcttctgtaattcatcgagatctcaaacctgccatccttttgaacgaagattgtacgctc
aagatctgtgatttcggcttggctaggattgtgcaccacgaaaagatacaacctacacca
tcgactacgtcgtcagatgatggtgccggtgttgccactgtcaacgacaggtcgaccgta
ccaatgacaacaccgacagagatggatagggaccagctaaagtctattccacgtcctaac
ttgtcgagacaactgaccaaacacgttgtcacacgatggtatcgtgctcccgagttgatt
ttaatccagccatatgcttctgcggtggatatctggagcttgggttgcatctttgccgag
ttactcagcatgcaagaagggagtgtgccatcgtatcaagacagagttcctctgttccct
ggagggtcgtgttttccgctttcgggtgacaaggggacaaagggggcaactggatcagat
gaacgcttggatcagttaagtgttatcttcagtgtgataggaatgccgtcagaagaagat
cttcaatcggttggcaaggccaacgattacatcaagagtctcgacaagaagccagggaga
aacattgagtcgttgtatcctgcagctgacccagaggcaattaatcttctcaaaacaatg
ctaatgttcaatccggcaaaaagatgcactgcagatgaagcccttgagcacgagttcttg
aaacctgtgagatgcaaagcacgggaggtaagaatggtacagtcgacttcttatctcgtt
cgtgaatag

DBGET integrated database retrieval system