KEGG   Thalassiosira pseudonana: THAPSDRAFT_33794Help
Entry
THAPSDRAFT_33794  CDS       T01078                                 

Definition
sterol delta7 reductase-like protein (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
tps  Thalassiosira pseudonana
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    THAPSDRAFT_33794
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     THAPSDRAFT_33794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 382 aa AA seqDB search
PTLEGAKFVLAFMAVAFVLERFLPGKIDFGPETATGHVPKYVDNAVTHCFVYSILFFLGS
NLGPCGDPYDFGIMYDVFPSSLSFLNIFGIVFCIFLMLKGIHFPSTEDNGSSGSWVKDYL
WGTELYPRVFGLDLKRFINCRFSMTYWQLAGFSFCYRSYTLHGNEMDWGLFFSALSQYIY
LVKFFVWEMGYMRSIDIIVDRAGYEIQWGCLVWVPAVYTFHSRFLVQHPSGLSFSMALAI
FVLSILGVLLNYAADRERDVFRASKGKCLVWGSKPRYITAKYTIVDRKTGKSTQKTSLLL
ASGFWGMARHFQYFFELTAAYSWCLLANPLQNGVLVMFYAVFLNGLLVDRAKRDTDKCRL
KYGKYYDEYCALVPYKIIPGIY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
cctaccttagagggtgcaaagttcgtattggcgttcatggcagtggcgtttgtgttggaa
cggttcttgcctggaaagattgattttggacctgagactgccacgggacacgtgccgaaa
tatgtcgacaatgctgtgactcactgctttgtgtactcaattctcttcttcttggggagc
aatcttggaccgtgtggagatccatacgattttggcatcatgtacgacgtatttccatcc
agtctatcattcttgaacatctttggtattgttttctgcatctttttgatgctcaaggga
atccatttcccttctacggaagacaatggctcatctggatcgtgggtgaaggattatctt
tggggaactgagttgtaccctcgcgtattcgggcttgatctcaaacgattcattaattgt
cggttcagtatgacgtattggcaattggctggattctctttctgctaccgttcgtacaca
ctccacggcaacgaaatggattggggactcttcttctcggctctcagtcagtacatctat
ctcgtcaaattcttcgtgtgggagatgggatacatgcgttcgattgacattatcgtcgat
cgagccgggtatgagattcagtggggatgcctcgtttgggtgccagccgtctacaccttc
cactctcggtttctcgtgcaacatccatctggtctctcgttttcaatggcgttggcaatc
ttcgtgctcagtattcttggggtgcttctcaactatgctgctgacagagaacgtgatgtg
tttcgtgccagtaaaggcaaatgcctcgtttggggttcaaagccacgttacatcactgca
aaatacaccatcgtggatcgtaagacagggaaatcaacacaaaagacgtctctgctcctt
gcatctggtttctggggaatggctcgtcactttcagtactttttcgagttgactgcagcg
tattcttggtgcttgttggcaaatcctcttcagaatggagtcttggtcatgttctacgca
gtctttttgaacgggctgcttgtagatcgagcgaagagggatacggacaaatgtcgtttg
aagtacggcaaatactacgacgagtactgtgctttggtaccttacaaaattatcccaggg
atatattaa

DBGET integrated database retrieval system