KEGG   Thalassiosira pseudonana: THAPSDRAFT_33937Help
Entry
THAPSDRAFT_33937  CDS       T01078                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    THAPSDRAFT_33937
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     THAPSDRAFT_33937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 7446150
NCBI-ProteinID: XP_002289870
JGI: 33937
UniProt: B8BZU1
Position
4
AA seq 313 aa AA seqDB search
MSEPSSLPLPIVTAVSIIVLTSFLLSLLYLKNTKPKPALDPVEFTPLPLIKKESVSHDTR
RFTFALPNGPTGKLGLPVGQHITLKFTETLADGTTKNHQRSYTPVTGDDVDGSVTFVIKV
YKAGVHPKFPEGGKMSQHLDSLEIGDTVDMRGPKGHMTYHKNGNFTVHPILKRDPIQKRT
AKHFGMIAGGTGITPMLQIMHAVLRDEPESDVTVSLLYANQTEDDILVREELEACLKQYP
GRFKLHYTLDRPPKKWDYSTGFITKEMVEEHLPKAASDGSTQILMCGPPPMVKFACIPNL
EALGFKKTDYFVF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaccatcatccctaccactcccaatcgtcactgccgtctcaataatcgtccta
acctccttcctcctctccctcctctacctcaaaaataccaaacccaaaccagcactggat
cccgtcgaattcaccccgctgccactcatcaagaaagaatccgtcagccacgacactcgt
cgcttcacctttgctttgcccaatggacctaccggcaaactcggcctccccgtcggacaa
cacattacattgaaatttacagaaacgttggcagatggaacgacgaagaatcatcagagg
agttatactcccgtaactggagatgatgtcgatggaagcgtgacgtttgtgattaaagtg
tacaaggcaggtgttcatccaaagtttccggagggtgggaagatgagtcagcatttggat
tcgttggagattggggatacggtggatatgagagggcctaaggggcacatgacgtaccac
aaaaatggcaactttaccgtccacccaatcctcaaaagagacccaatccaaaaacgcacc
gctaaacactttggaatgatcgctggaggtacaggaatcacacccatgcttcaaatcatg
catgcagttcttcgcgatgaacccgagtccgacgttacagtgtctttgttatacgctaat
caaacggaggatgatattctcgtcagagaggagcttgaagcatgtcttaaacaatacccc
ggtcggttcaagttgcattacactcttgatcgtcctcctaagaagtgggattacagtacc
ggattcattacgaaggagatggtggaggagcatttacccaaggcagcgagtgatgggagt
acgcagattttaatgtgtggaccacctccaatggtgaagtttgcgtgtattcctaacctg
gaggcgttgggattcaaaaagacggattacttcgtgttctaa

DBGET integrated database retrieval system