KEGG   Thalassiosira pseudonana: THAPSDRAFT_34187Help
Entry
THAPSDRAFT_34187  CDS       T01078                                 

Gene name
ACAS2
Definition
acetyl-coenzyme a synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THAPSDRAFT_34187 (ACAS2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_34187 (ACAS2)
   00620 Pyruvate metabolism
    THAPSDRAFT_34187 (ACAS2)
   00640 Propanoate metabolism
    THAPSDRAFT_34187 (ACAS2)
Enzymes [BR:tps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     THAPSDRAFT_34187 (ACAS2)
Lipid biosynthesis proteins [BR:tps01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   THAPSDRAFT_34187 (ACAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 645 aa AA seqDB search
YKANHATSIQDTSAYWSDLAKSKLDWFAPFPAAVTGSFKDGSVSWFAGGKINVCHNAVDR
YCLAPYNRGDEIAIIWEGDEPSSVKNITYRELQLSVCRIANALKSQGVQKGDVVTLYMPM
VPELAMTMLACARIGAVHSVIFAGFSADAIADRIDDAKSKWVVTASAGSRGGRNLPLKSI
CDAAIMKERCAGVVEKVFVFDGAGANGNEWEKKDVHVKFTELVEAQRPVCPCEWMDAEDP
LFILYTSGSTGRPKGLLHTTGGYSIYAMHTTANSFGLSQQTGPSSPNDPHKDVYACVADA
GWITGHTYIVYGPLLNGISTFMFESTPMYPDHGRYWDMVQRHKITVFYTAPTAIRSLMRF
GDDAPKKYDLSSLKVLGTVGEPINPAAWKWYFDVIGKGNCAVVDTYWQTETGGHVITNLP
GVTPMKPGSCTLACYGIEVVVLDAATGQEINTTEAEGVLAIKQPWPGMARTCLGDHQRYL
NVYMKPYPGYYFAGDGCRRDEDGFIWITGRVDDVLNVSGHRIGTAEVESALVAHPAVAQA
AVVGVPHDIKGQGICCFTTLAEGYPESDELIKELRNAVRTSIGPFATPDMIIPTSALPMT
RSGKIMRRILRKVAAGELDTLGDTTTLADPSVVDALIAKVEQSRK
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
tacaaagccaaccatgccacctccatccaagacacttccgcttactggtcggatcttgca
aagtccaaattggactggttcgctcctttccctgctgcagtgacgggttcgttcaaagat
ggaagcgtctcttggtttgctggtggaaaaattaacgtgtgccataacgccgtggatcgt
tattgtcttgcgccgtacaaccgaggagatgagatagccatcatctgggagggcgacgag
ccctcgtcagtaaagaatatcacgtaccgtgagctccagttgagtgtatgccgtattgca
aacgcactcaagtctcagggagtacaaaagggagacgtcgtcacgctttacatgccgatg
gttccagagttggccatgacgatgcttgcatgcgctagaattggagctgtacactctgtt
atctttgctggattcagtgctgatgccatcgcagacagaatcgatgatgccaagtcaaaa
tgggttgtaacagcgagtgcaggaagccgtggaggaagaaacctccccctcaagtcaatt
tgtgatgcagcgattatgaaggaacgttgtgcaggagtggtggaaaaggtgtttgtattt
gatggggctggggcaaatggcaatgaatgggagaagaaagatgttcatgtgaagtttaca
gagttggttgaggcacagaggcctgtgtgtccttgtgaatggatggatgctgaggaccca
ttgttcatcctgtacacgtcgggaagtactgggaggccaaagggactccttcatactact
ggaggatactctatttatgcaatgcatacaactgccaacagtttcggactttcgcagcaa
actggaccttcctctcccaacgatcctcacaaagatgtgtacgcgtgcgttgccgatgca
ggatggattactggacacacctacatcgtctacggtcctctgttgaacggtatctctacc
ttcatgttcgagtccactccaatgtatccggatcacggtcgttactgggatatggtgcaa
cgtcacaagattactgtcttttataccgcccccactgcgattcgtagtttgatgaggttc
ggtgatgatgctcctaaaaaatacgatttgtcttcgttgaaggtgttgggtacggttgga
gagccaatcaatcctgctgcttggaagtggtattttgatgtcatcggaaagggcaactgt
gctgtggttgatacttattggcagacggagacgggaggccatgtcattaccaacttgcct
ggtgtcacaccaatgaaacctggctcttgcactctcgcatgctacggtattgaggtggtt
gtcttggacgcggcaactggacaggaaatcaacaccacggaagcagagggagttttggca
atcaaacaaccttggcctggaatggctcgtacgtgtttgggagatcaccaacgctatctc
aatgtgtacatgaaaccttatcctgggtactactttgctggagatggatgtcgccgtgat
gaggatggtttcatctggatcactgggcgtgtggacgacgtgttgaatgtttctggacat
cgcattggtaccgctgaggttgaatctgctcttgtggctcaccctgcggttgctcaggct
gcagttgtcggtgtaccccacgatatcaaaggacaaggtatctgctgcttcactactctt
gcggaggggtatcctgagagtgatgagttgatcaaggagttgcgcaatgcagtacgaact
tctatcggtccattcgctactcctgatatgattatccctacctctgctcttcccatgaca
cgttcaggaaagattatgaggcgaatcttgcgaaaggtggctgcgggagagctggatacc
cttggagatacgacaactcttgctgatccttctgtggtggatgctcttattgccaaagtt
gaacagtcgagaaagtag

DBGET integrated database retrieval system