KEGG   Thalassiosira pseudonana: THAPSDRAFT_3448Help
Entry
THAPSDRAFT_3448   CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tps  Thalassiosira pseudonana
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    THAPSDRAFT_3448
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     THAPSDRAFT_3448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 243 aa AA seqDB search
MSDNNSKCDCPVGSPFKGFCPFSLVLFAGTSYSYVRYLSRKNETKSASTSTDQPRPVVIA
GPSGVGKGTLIELLRKKYPTEFGFSVSHTTRKPREGEQDGVHYNFTTVETIKGEIDEGKF
VEYANVHGNYYGTSVQAVESVQKQGKICILDIDVQGVRNVKKSALDAIYVFVAPPSMDEL
EKRLRGRGTETEEAVLKRLGNAKVELDFGLGEGNFDRVFTNDDLDKTFEAMVEQFKSWYP
QLS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacaacaacagcaaatgcgactgcccagtcggcagcccattcaaaggattctgc
cccttttccttggtgctattcgccggcacgtcgtattcttacgttcgctatctctccaga
aagaatgagacgaagtcagcctccacatccacagatcagcctcgaccggtggtgattgct
ggtccatcaggcgtcggcaaaggcactctaattgaactccttcgtaagaagtacccaaca
gaattcggattcagtgtcagccacacaacacgaaagccacgcgagggagaacaagatgga
gtacactacaatttcaccaccgtcgagaccatcaaaggcgaaatcgacgaggggaagttt
gtagaatatgccaatgttcatggaaactactacggaacgagcgtccaagcggtagaaagt
gtgcagaaacaaggcaagatttgcattcttgatattgatgttcagggggtacgaaacgtg
aagaagagtgcattggatgcaatttacgtgtttgtggcaccaccttctatggatgaattg
gagaagaggcttcgtggacgtggaacggagacggaggaggctgtgttgaagaggttgggg
aatgcgaaggttgagttggattttggacttggagaggggaattttgatagggtgtttacg
aatgatgatttggataaaacgtttgaggcgatggtggaacagttcaagagttggtatccg
cagctttcttaa

DBGET integrated database retrieval system