KEGG   Thalassiosira pseudonana: THAPSDRAFT_34511Help
Entry
THAPSDRAFT_34511  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tps  Thalassiosira pseudonana
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THAPSDRAFT_34511
   01212 Fatty acid metabolism
    THAPSDRAFT_34511
  Carbohydrate metabolism
   00640 Propanoate metabolism
    THAPSDRAFT_34511
   00650 Butanoate metabolism
    THAPSDRAFT_34511
  Lipid metabolism
   00062 Fatty acid elongation
    THAPSDRAFT_34511
   00071 Fatty acid degradation
    THAPSDRAFT_34511
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    THAPSDRAFT_34511
   00310 Lysine degradation
    THAPSDRAFT_34511
   00380 Tryptophan metabolism
    THAPSDRAFT_34511
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    THAPSDRAFT_34511
Enzymes [BR:tps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     THAPSDRAFT_34511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 248 aa AA seqDB search
KGGGVGLITLHRPKALNALCDALFDDLIHAINAFEDDEDIGCVVITGSPKAFAAGADIEE
MAKREFATVYKKNMFSQWADVTKASKPIIAAVNGFALGGGCELAMMCDIILAGSNAHFGQ
PEINLGVIPGAGGTQRLVRAIGKSKAMEMVLTGNRLSAKEAVDAGLAAKVIDTEMLVDEA
VKMGFTIAEKSGVAVRMAKEAVNVADEMTLSEGLRFERRMFHALFATKDQKEGMGAFLEK
RKPNFTNE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
aaaggaggaggggttgggctgatcacactccatcgtcctaaggctctgaacgcgctctgt
gacgccttgtttgatgatctcattcacgccattaatgcatttgaggacgatgaggatatt
gggtgcgttgtcattactggtagtcctaaagcgttcgctgcaggtgctgacattgaagaa
atggccaaacgagaattcgctactgtctacaaaaagaacatgttctcgcaatgggcagat
gtaactaaagcatccaaacccatcattgctgcagtgaatggctttgctctcgggggcggt
tgtgaacttgcaatgatgtgtgatattatccttgccggatccaacgcccatttcggacaa
cccgaaatcaatctcggtgtcattccaggggcaggagggacacaaagattggtacgtgca
attggcaaatccaaagcaatggagatggtattgactggtaacagattgagcgctaaagag
gcagttgatgcgggactggctgcaaaggttattgatactgaaatgttggtcgacgaagct
gtcaagatgggatttacaattgctgaaaagagtggagtggctgtacgaatggcaaaggaa
gcagtgaacgtggctgatgaaatgacgctgagtgagggattacgatttgagaggagaatg
ttccatgcattgtttgcaacaaaggatcaaaaagagggtatgggagccttcttggaaaag
agaaagccaaattttacgaacgagtga

DBGET integrated database retrieval system