KEGG   Thalassiosira pseudonana: THAPSDRAFT_35084Help
Entry
THAPSDRAFT_35084  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
tps  Thalassiosira pseudonana
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:tps03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 158 aa AA seqDB search
SYFDAVKSIGTVHTVEQFWTLYNHLVRPNNLPTTTDYHFFREGIEPTWEDPSNARGGKWI
VRLKKGLASRYWEELLLALLGGQLSGGGVSPDEICGAVISIRYNEDIVSVWNKSAGNREV
VDKVRDGIKRVLHLPSGVHMEYKPHQDSLADRSSFRNT
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
tcgtactttgacgctgtcaaatccataggaacggttcatacggtagaacagttctggaca
ctctacaaccatctagtccgtccaaacaacctccctaccactactgactatcacttcttc
cgcgaggggatagaaccaacgtgggaggacccctccaacgcccgtggaggcaaatggata
gtccgtctaaagaaaggtctggccagtcgatactgggaagaactcctcctagccctcctc
ggaggacagttgagtgggggtggagtatcgcccgatgagatatgcggggcggtcatttcc
attagatacaatgaggatattgtgagtgtgtggaacaagagtgcggggaatagagaggtt
gtggataaagtgagagatgggattaagcgtgtgttgcatttgccgagcggggtgcatatg
gagtataagcctcatcaggatagtttggcggataggagttcgtttaggaatact

DBGET integrated database retrieval system