KEGG   Thalassiosira pseudonana: THAPSDRAFT_35084Help
Entry
THAPSDRAFT_35084  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
tps  Thalassiosira pseudonana
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THAPSDRAFT_35084
Translation factors [BR:tps03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    THAPSDRAFT_35084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 158 aa AA seqDB search
SYFDAVKSIGTVHTVEQFWTLYNHLVRPNNLPTTTDYHFFREGIEPTWEDPSNARGGKWI
VRLKKGLASRYWEELLLALLGGQLSGGGVSPDEICGAVISIRYNEDIVSVWNKSAGNREV
VDKVRDGIKRVLHLPSGVHMEYKPHQDSLADRSSFRNT
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
tcgtactttgacgctgtcaaatccataggaacggttcatacggtagaacagttctggaca
ctctacaaccatctagtccgtccaaacaacctccctaccactactgactatcacttcttc
cgcgaggggatagaaccaacgtgggaggacccctccaacgcccgtggaggcaaatggata
gtccgtctaaagaaaggtctggccagtcgatactgggaagaactcctcctagccctcctc
ggaggacagttgagtgggggtggagtatcgcccgatgagatatgcggggcggtcatttcc
attagatacaatgaggatattgtgagtgtgtggaacaagagtgcggggaatagagaggtt
gtggataaagtgagagatgggattaagcgtgtgttgcatttgccgagcggggtgcatatg
gagtataagcctcatcaggatagtttggcggataggagttcgtttaggaatact

DBGET integrated database retrieval system