KEGG   Thalassiosira pseudonana: THAPSDRAFT_35182Help
Entry
THAPSDRAFT_35182  CDS       T01078                                 

Definition
set domain-containing protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
tps  Thalassiosira pseudonana
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    THAPSDRAFT_35182
Enzymes [BR:tps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     THAPSDRAFT_35182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 189 aa AA seqDB search
EKGAVTGRAVRASQRRMLKSLASLGDASKTVDRLVSRDREERLRFDKSLIHGWGVFAEEA
INAGDMIIEYRGELIGNAVADKRELEYERAKIGSDYMFRIDEFWVCDATKLGNVARFINA
SCCPNCYTKIITANETKRIVIFAKKNIQRGEELCYDYKFQMEHEKEKRIPCYCGSSECRG
FMNWVSVLV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gaaaagggtgcggtcactggtcgtgctgtaagagccagtcagcgacgtatgctgaagagc
cttgccagtctaggtgatgcttccaaaacggttgatcgattggttagtcgcgatcgagaa
gaacgacttcgttttgacaagagtcttattcatggctggggagtgtttgccgaagaagca
ataaacgctggtgacatgatcatcgagtaccgaggggaactcattgggaatgccgttgca
gacaaacgtgaattggaatacgaaagagctaagattggcagtgattacatgttccgaatc
gacgagttctgggtatgcgatgcaacaaagcttggtaacgtagctcgtttcatcaacgcg
agttgctgtcccaattgctacaccaagattattacagcgaatgagactaaacgcattgta
atctttgcaaagaagaacatccaacgtggtgaagagctatgctatgactataaattccag
atggaacacgagaaagagaaacggatcccttgctactgtggatcttcagagtgccgtggc
ttcatgaactgggtaagtgttttggtttga

DBGET integrated database retrieval system