KEGG   Thalassiosira pseudonana: THAPSDRAFT_36275Help
Entry
THAPSDRAFT_36275  CDS       T01078                                 

Definition
histone acetyltransferase MOZ/SAS-type hat
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     THAPSDRAFT_36275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 344 aa AA seqDB search
WKYYVHYRDFNRRMDEWITMDRIVSPPSEHLAVDVVTTIAAPVLDEHEGMDDAALKEHEE
VTKVKNVATLELGPYQMDTWYFSPLPKELFKDGGVVDVLYVDEFSLNFFTRKSELLRYQA
KELPKNRRHPPGNEIYRCGNLSMFEVDGFEERIYCQNLCYIAKLFLDHKTLYFDVDPFLF
YVLCEVDERGYHPVGYYSKEKYSDVGYNLACILTFPSHQRKGYGRFLIAFSYELSKKEEK
VGSPEKPMSDLGQQAYIPYWTSTIVDFMLNHSGNDTSMSIMDIAKKTSIMAEDIVFALNT
LGILKFVNGVYFISAERGMLEELAKKHPVKEPRVDPSKLHWTPY
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
tggaaatactacgtccactatcgagactttaaccgtcgcatggatgaatggatcacaatg
gatcgtatcgtgagtcctccatcggaacacttggccgtggatgtggtaactactattgct
gctccagtcctcgacgagcacgagggtatggacgatgcagcgttgaaagaacacgaggaa
gtaaccaaagtcaagaacgttgctacgctcgagctgggcccgtatcaaatggatacgtgg
tacttctcaccccttccgaaggaactgttcaaggatggtggtgtggtggacgtcctttat
gtggatgagttttcattgaacttctttacgagaaagagtgaattgcttcgatatcaggcg
aaggagctaccaaagaataggagacatccgcctgggaatgagatttatcgttgtgggaat
ctgagcatgtttgaagtggatggctttgaggaacgcatctactgccaaaatctgtgctac
attgcgaagctattcctcgatcacaagactttgtactttgatgttgatccattcctgttt
tacgtcctttgcgaggtagatgagcgtggctaccaccccgtcggatactactccaaagaa
aagtattcagacgtaggctacaacctcgcatgcatcctcacttttccatctcaccaacgc
aaaggctacggtcgcttcctaattgctttctcctacgaactcagcaagaaagaagagaag
gttggaagtcccgaaaagccaatgtctgacctcggccaacaagcctacattccgtactgg
acgtctacaattgttgacttcatgttgaatcattctggaaacgatacgagtatgagtatc
atggatatagcaaagaagacgtccatcatggcagaagacattgtatttgcattgaatact
ctgggcatactcaagtttgtgaatggagtgtactttatatcagcggaacgaggaatgctg
gaggagttggcgaagaagcatcctgtgaaggagccccgcgttgatccaagcaagttgcat
tggacgccgtat

DBGET integrated database retrieval system