KEGG   Thalassiosira pseudonana: THAPSDRAFT_3629Help
Entry
THAPSDRAFT_3629   CDS       T01078                                 

Definition
hypothetical protein
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     THAPSDRAFT_3629
Peptidases [BR:tps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THAPSDRAFT_3629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 600 aa AA seqDB search
MADACPHLREPTKAAWKRLRNPLTWGCDICHSTDGIWCCLSCGHIGCGRRAHLPALGGGH
SKHHYHTTHINQESISASSSDGKKKRVKILRILRSSSKGSCISNDAVGNADSQSNTAEES
AGEVGPSGHEVCIDIVSKAVHCYECDDYVLSDAPWLAKLRNEIDVIEQRREETSSTNSST
DDEERKEIMDYDYEMVDPLDDDANKEQQINDKKMPAAASAQAEVDSPANETISPYEPGIT
GLTNLGNTCYMNSVVQMLSHCSGFRSFFRDFLRAAAPLRLAGEGGYKISRQSTTRLKDTL
HVDTSPDKLALTEATHALLRVLWSGRWPYVSPRYFVHAVWKHGGLFAARKQQDANEFLNF
YLGRVDDELKAPKATSSVMMDLFGIDQYQEVQCDGCSTVTKRTEPLLGLVLSLPDEDKTD
ASVMADSDSVKVEKEIDLLECFKSLQTTGRFIEENQFHCDKCNCKRDATWSVALQRRPQS
LLISLRRTLWNPEKGVHKDSRRVKFPVELDASQLLEMENDKTSPVDAFEGCHYSLISVVS
HSGSSPFVGHYISWCRVDGVNGKKWYLFNDSSVTRASEANVLEAEAFILLYERRGLPSAG
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgcatgtcctcatctacgcgagccaacaaaagctgcttggaaacgactacgt
aatccattgacatggggctgtgatatctgtcatagcactgatggaatttggtgctgtctg
agctgtggccacattggatgtggtagacgagcacatcttccggctctcggtggaggtcac
tcaaaacatcactatcacacaactcacatcaaccaagaaagcataagtgcaagtagcagc
gatggaaagaagaaacgagttaagatattgaggatattgcgtagttcgagcaaaggaagt
tgtattagcaatgatgcagttggtaatgctgatagccagagcaatactgcagaggagagt
gctggcgaggttggtcctagtgggcatgaagtttgtattgacatcgttagcaaggctgtt
cattgctacgaatgcgatgattacgtactatcagatgctccatggttggcgaagttgcgc
aatgaaatagacgtgattgaacaacgtcgtgaggaaacctcgtcaactaattcatcaacc
gatgacgaagaacgaaaggaaatcatggactatgattacgagatggtggatcctttagac
gacgatgcgaacaaagaacaacagatcaatgacaagaaaatgccagcagcagcgagtgca
caggctgaagtagactcgcctgccaacgaaaccatctcgccttacgaacctggaatcact
ggacttacaaacttgggaaatacctgctacatgaatagcgttgtacaaatgctttcgcat
tgttctggtttccgtagtttctttcgtgacttcctacgagcagctgcccccttacgtctt
gcaggcgaaggggggtacaagatatcgcgacaatctacgacaagactaaaagatactttg
catgtcgacacatctcccgacaaactagcgttgacggaggcaacacatgcattactacgg
gtattgtggagtggtagatggccttacgtcagtcctcgatactttgtccatgcagtttgg
aagcatggggggctttttgcagcgaggaagcaacaagacgctaacgagtttctcaacttt
tacctcggtagagtagatgatgagctcaaggctccaaaggccactagctcagtgatgatg
gatctatttggtatcgatcagtatcaagaggtacagtgcgatggatgcagtactgtgaca
aaacggacagagccactgttaggtttagtactatcccttccagacgaggataagacagat
gcaagtgttatggctgactctgattcagtcaaggttgagaaggagattgatctgctagaa
tgcttcaaatccctgcaaaccaccggcagattcatagaagagaatcagtttcactgcgat
aagtgcaactgcaaaagggatgcaacttggagtgtcgcgctgcaacgtagacctcagtct
ctgctcatatcattgcgtcggacgctgtggaatccagaaaagggcgtgcataaagacagt
aggagagtgaaattcccagtcgagctggacgcatcacaattgcttgagatggagaacgat
aagacttcgccagttgatgcttttgaaggatgtcattatagccttatctctgttgtttcg
cattcgggttcaagcccgtttgttggtcattatatctcgtggtgccgggtagatggagta
aatggcaagaagtggtatctgttcaatgactcgtctgtaacgcgtgcgagtgaggccaat
gtgttggaggccgaggcctttattctcttatatgagagacgaggactgcctagtgcgggg
tag

DBGET integrated database retrieval system