KEGG   Thalassiosira pseudonana: THAPSDRAFT_36971Help
Entry
THAPSDRAFT_36971  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tps  Thalassiosira pseudonana
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THAPSDRAFT_36971
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THAPSDRAFT_36971
  Amino acid metabolism
   00310 Lysine degradation
    THAPSDRAFT_36971
Enzymes [BR:tps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     THAPSDRAFT_36971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 378 aa AA seqDB search
VPTMGDSITEGTIVDIPVAPGDYVSEDDVVLVLETDKVSVDVRAPEGGCVVEILGEVDDV
VEVGSALYRLDTDGVKPAEGGGGSSSDAASPVAPAVETPAATPAAATPPAAAPPSTPPPE
KKATPPPTPQLPQMESITTNLGNRPERRSKMSRMRQRVATRLKESQNTAAMLTTFQEVDM
GNFMEMRHRHKDDFAKKHGVKLGFMSVFVKACTSALQEVPAINAYIDDEAKEIVYRDYCD
ISVAVASPNGLVVPVLRNTEFMTFADVERTIALFGQKAKDGTLAIDDMAGGTFTISNGGV
FGSLMGTPIINQPQSAILGMHATKMRAVVDEKGNVVARPMMYLALTYDHRLIDGREGVTF
LKSVADKITDPARLVFDI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaccatgggagactccatcaccgaaggaaccatcgtcgacattcccgtagcaccc
ggcgattatgtctccgaagacgacgtagtattagtcctcgaaactgacaaagtttccgta
gacgttcgtgctccggagggaggatgtgtggtggagattttgggggaggtggatgatgtt
gtggaggtgggtagtgcgttgtataggttggatacggatggggttaaacctgctgaggga
ggaggaggaagtagtagtgatgctgcttctccggtagctcctgcagtggagactcctgca
gcaactccagcagctgcaacaccaccagcggcagcaccaccatccactccaccaccagaa
aagaaagcaacacccccaccaacaccccaactcccccaaatggaatccatcacaaccaac
ctaggaaaccgtcccgaacgccgctccaaaatgtctcgcatgcgtcaacgcgtcgccacc
cgtctcaaagaatctcaaaataccgcagccatgctcacgaccttccaagaagtcgacatg
ggtaactttatggaaatgcgtcaccggcacaaagacgactttgccaagaagcatggtgtc
aaacttggttttatgagtgtgtttgtcaaggcatgtacaagtgcattgcaggaagttcct
gcgattaatgcgtatattgacgatgaagcgaaggagattgtataccgtgattattgcgat
attagtgtggcggtggcgagtccgaatgggttggtggtgcctgttttgaggaatacggag
ttcatgacttttgccgatgtggaacgtactattgccttgtttggacagaaggcgaaggat
gggacgttggcgattgatgatatggcagggggaacgtttaccatttcgaatggaggtgtg
tttggttcgttgatgggtacgcctattatcaatcagcctcagagcgccattttgggtatg
catgccaccaagatgagggctgtagtggatgagaaggggaatgtggtggcgaggcccatg
atgtatttggctttgacgtatgatcatcgactgattgatgggagggagggggttacgttt
ttgaagagtgtggctgataagattacggatccagcgaggttggtgtttgatatttag

DBGET integrated database retrieval system