KEGG   Thalassiosira pseudonana: THAPSDRAFT_37054Help
Entry
THAPSDRAFT_37054  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tps  Thalassiosira pseudonana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 251 aa AA seqDB search
QLAWHCAGTYSKEDGSGGSNGARMRFNPEASWGANAGLDLPRKVLESVKEKHPDISYADL
YTLSGVVAVEEAGGPKIPFRLGRTDADSGETSPKTCGLPDADKGSRANTTQHVRDVFYRM
GFNDREIVALLGAHALGRCHTDRSGYWGPWTFAENTFSNEYFRLLVEERWSPKMSHNGKP
WEGPDQYEDSTGKLMMLPSDMILVQDPTFKKIVELYAKDEDAFFKDFASAFSKLLELGVD
FPSTKPWYQFW
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
cagctagcgtggcactgtgccggaacctactcaaaagaagatggcagcggtggatccaac
ggtgctcgcatgaggttcaatccagaggctagttggggtgccaacgccgggcttgatctg
cctagaaaggtcttggagtctgtcaaggagaagcatcctgacatatcgtatgcagatctt
tatactctgtcgggtgtggttgctgttgaggaagctggaggtcctaagattcctttcaga
ctaggacgaactgatgccgacagcggagagacgagccccaagacttgtggtctgcctgat
gctgataaagggtctcgtgccaacactactcagcacgtccgtgatgtgttctatcgcatg
ggattcaacgatcgtgaaatcgtagctctccttggagcacatgcacttggtcgttgtcac
accgatcgcagtgggtactggggtccgtggacgtttgcagagaacacatttagcaacgag
tactttcgtttgttggtagaagaacgttggtctcctaagatgtctcacaacggcaagcct
tgggagggccctgatcagtacgaagattctacgggaaagctaatgatgttgccgagcgat
atgattcttgttcaagatcctacgtttaagaagattgtggagctctatgcaaaagacgag
gatgccttcttcaaagacttcgcatctgccttttcgaagttgcttgagcttggagttgat
ttcccatcgaccaaaccttggtatcagttttggtga

DBGET integrated database retrieval system