KEGG   Thalassiosira pseudonana: THAPSDRAFT_37187Help
Entry
THAPSDRAFT_37187  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tps  Thalassiosira pseudonana
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tps03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 669 aa AA seqDB search
LNTSYDRCVILTNLPKVNEAKYEKLSKVVLKLVSRIGNLASYEGSDEFTGFYMPFDKEGD
ATKGCAFIEYESASDAKKAMEVLDDYKFDKNHSLKVTLHERAAELERVEEGEFTQPEPEP
FKERANTMAWLEDSCQRDQFSIRHGNETEVLWCDGKGDPVVDYDGSREKKAGINWCDYYT
QWSPKGSYFATLVPNKGVILWGGESFEKLGRFPAPGVDFVSFSPQENYIMTNNNNRNDPN
AIKVFSIQSGKLLRAFPLYPKDFLEESANAENVPPPPFQWSFDDKYLARMGKDLISVFET
STMKLLDKRSLACDGIHEFQFSPKANIIAYWAPEHKNQPAHVDLIEIPSRKKLRQKNLFN
VSNCQMVWQEGGEYLGVKVTRHTKSKKTLYNNLELFRVNEPGIPVEMLDVKDAVMAFQWE
PKGSRFAIIHAENPTSTKVNVTFYDITEKQIISEVNKVETLEGKQCNCIFWSPAGRTIIL
AALGDSASGTLEFYDVENKSLTVKEHYRANQVLWDPSGRTVATTVSQPIGGGHFKFAMDN
GYILWTFQGKQLSQASFETFYQLQWRPRESLSTKEEVAEIAKNIKKYEKQFNAFDEAKKK
KLRLEETKGKRRSRSEFRNTMARLKEWRNRQKQERMELNGGYDSEDENNYTTKEVVIETV
LNTKEELVY
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
ctcaacacctcctacgatcggtgcgtcatcctcaccaacctccccaaagtaaacgaagcc
aaatacgaaaagctatccaaggtggtgttgaaactggtctctcgcatcggcaacttggcg
agttatgagggcagtgacgaattcacgggtttctacatgccattcgacaaagagggggat
gccaccaaggggtgtgccttcatcgagtacgagagcgcaagtgacgcaaagaaggccatg
gaggtgttggacgattacaagtttgataagaaccactctctcaaggtgacattgcacgag
agggcggcggaactggaaagggtggaggaaggggagtttactcaaccggagccggaaccg
ttcaaggagcgggcgaacaccatggcgtggttggaggatagttgccaacgggaccaattt
tcaatccgacatgggaacgagacggaggtgttgtggtgtgatggaaagggggatccggtg
gtggattacgatggttcacgagagaagaaggcgggtatcaactggtgtgattattacacg
cagtggtctcccaaggggagttactttgccaccctcgttcctaataagggagttattttg
tggggtggggagagctttgagaagcttggacgtttccctgcaccgggtgtggatttcgtg
agcttttcgccacaggaaaattacatcatgacgaacaacaataacaggaatgatcctaat
gccatcaaggtgtttagcattcagagtggaaagttgttgagggcgttcccgttgtatccc
aaagactttttagaggagagtgccaatgcagagaatgtaccaccccctccgttccagtgg
agttttgatgacaagtatctagctcgcatgggcaaagatctcatctccgtctttgaaacg
agcacgatgaaacttctcgacaagcgctctttggcatgcgatggtatccacgagtttcaa
ttctcgcccaaagccaacattatcgcatactgggcacccgagcataagaatcaacctgct
catgtggatcttattgagattccaagtcgtaagaagcttcgtcagaagaatctcttcaat
gtgtctaattgtcaaatggtgtggcaggagggtggggagtatttgggtgtcaaggttacg
agacataccaagtcgaagaagacattgtataataacttggagttgtttagggtgaatgaa
cctggtattccggtggagatgctggatgttaaggatgccgtcatggcgttccaatgggag
ccaaaaggatctcgctttgccatcattcatgcagagaacccaaccagtaccaaggtcaac
gtcacattctacgacatcaccgagaagcaaatcatttcagaagtgaacaaggtcgagacc
ttggaggggaagcagtgtaattgcatcttttggtcacctgctggacgtactatcatcttg
gctgctttgggagactctgcctcgggtactcttgagttttacgacgtggagaacaagagt
ttgaccgtcaaggagcattatcgtgccaaccaagtgctttgggatccttctggacgtaca
gttgccaccacggtctcgcaacccattggaggaggccactttaagtttgcaatggacaac
ggatatatattgtggaccttccaaggtaaacaactctcccaagcaagctttgaaaccttt
taccaactccaatggcgtcctcgcgagtctctctcgaccaaggaagaggtcgccgagatc
gccaagaacatcaagaagtacgagaagcaattcaacgcgtttgacgaagccaagaaaaag
aaactccgtctcgaggagaccaagggtaagaggaggagtcgttccgagtttaggaacacg
atggctcgtttgaaggagtggaggaacagacagaagcaggagaggatggagttgaatggt
ggatatgatagtgaggacgagaacaactataccacgaaggaggtggttattgagactgtg
ctcaatacgaaggaggagctagtgtattaa

DBGET integrated database retrieval system